Protein Info for HMPREF1058_RS02760 in Phocaeicola vulgatus CL09T03C04

Annotation: peptidylprolyl isomerase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 281 signal peptide" amino acids 1 to 22 (22 residues), see Phobius details PF00160: Pro_isomerase" amino acids 39 to 152 (114 residues), 99.2 bits, see alignment E=1.5e-32 amino acids 231 to 279 (49 residues), 46 bits, see alignment 3.5e-16

Best Hits

KEGG orthology group: K03768, peptidyl-prolyl cis-trans isomerase B (cyclophilin B) [EC: 5.2.1.8] (inferred from 99% identity to bvu:BVU_0377)

Predicted SEED Role

"Peptidyl-prolyl cis-trans isomerase (EC 5.2.1.8)" in subsystem Queuosine-Archaeosine Biosynthesis (EC 5.2.1.8)

Isozymes

Compare fitness of predicted isozymes for: 5.2.1.8

Use Curated BLAST to search for 5.2.1.8

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See I9ILZ5 at UniProt or InterPro

Protein Sequence (281 amino acids)

>HMPREF1058_RS02760 peptidylprolyl isomerase (Phocaeicola vulgatus CL09T03C04)
MTSNKILLICLAFIALTACNAGSKRQTNHHMENEKRTLVKLETTMGNITVALYNETTKHR
DNFIKLVKEGVYDSTLFHRVIKQFMIQAGDPDSKNASDTAMLGSGDVGYTIPAEFNPKFF
HKKGVLAAARQGDDVNPEKASSGCQFYIVTGRKFTEPQLLGMENKINEQHEEALFDSLAR
QHMKEIYKMRKAGDNAGLLELQDTLEAQARELADKEEKFRFTPEQIKAYSTIGGAPHLDG
SYTVFGEVTEGMEVVNNIEIAKTNRADRPIENIRILKASIQ