Protein Info for HMPREF1058_RS02665 in Phocaeicola vulgatus CL09T03C04

Annotation: type I-C CRISPR-associated protein Cas5

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 226 PF09704: Cas_Cas5d" amino acids 9 to 216 (208 residues), 92.1 bits, see alignment E=2.5e-30 TIGR02593: CRISPR-associated protein Cas5" amino acids 10 to 47 (38 residues), 46.3 bits, see alignment 2.8e-16 TIGR01876: CRISPR-associated protein Cas5, subtype I-C/DVULG" amino acids 10 to 224 (215 residues), 195.6 bits, see alignment E=1.1e-61

Best Hits

KEGG orthology group: None (inferred from 87% identity to pdi:BDI_1179)

Predicted SEED Role

"CRISPR-associated protein, Cas5d family"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See I9TYC0 at UniProt or InterPro

Protein Sequence (226 amino acids)

>HMPREF1058_RS02665 type I-C CRISPR-associated protein Cas5 (Phocaeicola vulgatus CL09T03C04)
MEYTDKEYCLEVWGDWACFTRPELKVERVSYDVITPSAARAIFEAILFKRYAMRWQITKI
EVLRPIKWATIRRNEVGAVASKSPIIIEDKRQQKNTLLLLDVRYRIYAKLVFIPVKDRPK
EAFAKHQPSADENPMKYYQMFERRASQGQCFTQPYLGCREFSANWKYIESTDNLDYPLAE
DRDFGIMLYDMDFEENPQKPDAMFYRAQMKKGVIVVPDKDSEEVLR