Protein Info for HMPREF1058_RS02620 in Phocaeicola vulgatus CL09T03C04

Annotation: [FeFe] hydrogenase H-cluster radical SAM maturase HydG

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 472 TIGR03955: [FeFe] hydrogenase H-cluster radical SAM maturase HydG" amino acids 2 to 472 (471 residues), 933.7 bits, see alignment E=7.9e-286 PF04055: Radical_SAM" amino acids 92 to 245 (154 residues), 59.7 bits, see alignment E=4.3e-20 PF06968: BATS" amino acids 275 to 381 (107 residues), 66.7 bits, see alignment E=1.7e-22

Best Hits

KEGG orthology group: K03150, thiamine biosynthesis ThiH (inferred from 100% identity to bvu:BVU_0349)

Predicted SEED Role

"2-iminoacetate synthase (ThiH) (EC 4.1.99.19)" (EC 4.1.99.19)

MetaCyc Pathways

Isozymes

No predicted isozymes

Use Curated BLAST to search for 4.1.99.19

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See I9IKR5 at UniProt or InterPro

Protein Sequence (472 amino acids)

>HMPREF1058_RS02620 [FeFe] hydrogenase H-cluster radical SAM maturase HydG (Phocaeicola vulgatus CL09T03C04)
MYKADSKIAEEFIDHQEILDTLEYAHNNKSNRALIEQLIDKAAQFKGLSHREAALLLECD
QPDLTERIFRLAQEIKHKFYGNRIVMFAPLYLSNYCVNGCVYCPYHLKNKTIARKKLTQE
EIRKEVIALQDMGHKRLALEAGEDPLRNPIEYILESIQTIYSIKHKNGAIRRVNVNIAAT
TVENYRKLKDAGIGTYILFQETYHKENYESLHPTGPKSKYAYHTEAMDRAMEAGIDDVGL
GVLFGLNTYRYDFTGLLMHAEHLEATFGVGPHTISVPRICPADDISTQDFPDAISDDIFC
KIVAVIRIAVPYTGMIISTRESAATRRKVLNLGISQISGGSRTSVGGYAIPETPEENSAQ
FDISDTRTLDEVVNWLLDLGHIPSFCTACYRAGRTGDRFMSLVKSGQIANCCAPNALMTL
KEYLEDYAAPDTRAKGIQLIKKELEHIPNPKIKEIAIRNLKEIEEGKRDFRF