Protein Info for HMPREF1058_RS02610 in Phocaeicola vulgatus CL09T03C04

Annotation: 4Fe-4S dicluster domain-containing protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 488 TIGR04105: [FeFe] hydrogenase, group B1/B3" amino acids 4 to 467 (464 residues), 531.1 bits, see alignment E=1.1e-163 PF13237: Fer4_10" amino acids 149 to 213 (65 residues), 26.7 bits, see alignment E=2.1e-09 PF00037: Fer4" amino acids 150 to 171 (22 residues), 28.3 bits, see alignment (E = 5e-10) amino acids 197 to 217 (21 residues), 37.3 bits, see alignment (E = 7.5e-13) PF13187: Fer4_9" amino acids 178 to 217 (40 residues), 27.1 bits, see alignment 1.6e-09 PF12838: Fer4_7" amino acids 178 to 216 (39 residues), 31.8 bits, see alignment 7.1e-11 PF12837: Fer4_6" amino acids 196 to 217 (22 residues), 28.5 bits, see alignment (E = 4.8e-10) PF02906: Fe_hyd_lg_C" amino acids 235 to 464 (230 residues), 209.6 bits, see alignment E=2.7e-65

Best Hits

KEGG orthology group: None (inferred from 100% identity to bvu:BVU_0347)

Predicted SEED Role

"Periplasmic [Fe] hydrogenase (EC 1.12.7.2)" in subsystem Hydrogenases (EC 1.12.7.2)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 1.12.7.2

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See I9TWB1 at UniProt or InterPro

Protein Sequence (488 amino acids)

>HMPREF1058_RS02610 4Fe-4S dicluster domain-containing protein (Phocaeicola vulgatus CL09T03C04)
MAFTNNIMIVRHRLLTELVKLWKNGELTTDKIDRLPLELSPRRSKHAGRCCVHKERAVWK
YKSLPLLGLDMDDETDELTPLSEYAARAIERANNGKPKDNIMCVIDEACSACVQINYEIT
DLCRGCTARSCQYNCPKGAVHVHADTGKAWIDHDTCISCGICHKSCPYHAIVYIPVPCEE
SCPVKAISKDEHGIEHIDENKCIYCGKCMNACPFGAIFEISQTFDVLQRIRKGEQVVAIV
APSILGQFSTTIEQVYGAFRQIGFTDIIEVAQGAMSTVEHEAHELIEKLEEGQKFMTTSC
CPSYIELVNKYIPDMKKYVSGTGSPMYYAARIAKEKYPDAKIVFVGPCVAKRKEAQRDEA
VDFVMTFEEISSIFDAFEINLEIVQPYAMEFSSVREAHGFAQAGGVMGAVKAFLKMEADK
INAIQVSDLNKKNIGTLRAYAKSGKAPGQFIEVMACEGGCITGPSTHSGSNNGKRQLVQE
LAKQKKTY