Protein Info for HMPREF1058_RS02570 in Phocaeicola vulgatus CL09T03C04

Annotation: carbonic anhydrase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF00484: Pro_CA
  • amino acids 32 to 159 (128 residues), 59.9 bits, E=1.8e-20

Best Hits

Swiss-Prot: 56% identical to YTIB_BACSU: Putative carbonic anhydrase YtiB (ytiB) from Bacillus subtilis (strain 168)

KEGG orthology group: K01673, carbonic anhydrase [EC: 4.2.1.1] (inferred from 100% identity to bvu:BVU_0341)

Predicted SEED Role

"Carbonic anhydrase (EC 4.2.1.1)" in subsystem Carboxysome or Cyanate hydrolysis (EC 4.2.1.1)

MetaCyc Pathways

• cyanate degradation (2/3 steps found)
• CO₂ fixation into oxaloacetate (anaplerotic) (1/2 steps found)
• C4 photosynthetic carbon assimilation cycle, NADP-ME type (4/7 steps found)
• C4 photosynthetic carbon assimilation cycle, NAD-ME type (5/11 steps found)
• C4 photosynthetic carbon assimilation cycle, PEPCK type (7/14 steps found)
• 3-hydroxypropanoate cycle (6/13 steps found)
• gluconeogenesis II (Methanobacterium thermoautotrophicum) (8/18 steps found)
• glyoxylate assimilation (3/13 steps found)
• 3-hydroxypropanoate/4-hydroxybutanate cycle (6/18 steps found)
• superpathway of the 3-hydroxypropanoate cycle (6/18 steps found)
• Methanobacterium thermoautotrophicum biosynthetic metabolism (18/56 steps found)

KEGG Metabolic Maps

• Nitrogen metabolism

Isozymes

No predicted isozymes

Use Curated BLAST to search for 4.2.1.1

Sequence Analysis Tools

See I9TX29 at UniProt or InterPro

Protein Sequence (179 amino acids)

>HMPREF1058_RS02570 carbonic anhydrase (Phocaeicola vulgatus CL09T03C04)
MIDDILEFNKKFVESKGYEKYITNKYPDKKIAILSCMDTRLTELLPAALGIRNGDVKIIK
NAGGVISHPFGSVIRSLMVAIYELGVKEVMVVAHSDCGACHMNSNEMIEHMKARGIKQET
IDMIRFCGVDFGAWLDGFEDTEKSVKGTVRAIMEHPLIPEDIIVRGFIIDSVTGELTKV