Protein Info for HMPREF1058_RS02435 in Phocaeicola vulgatus CL09T03C04

Annotation: mechanosensitive ion channel

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 397 transmembrane" amino acids 24 to 45 (22 residues), see Phobius details amino acids 76 to 94 (19 residues), see Phobius details amino acids 103 to 128 (26 residues), see Phobius details amino acids 148 to 166 (19 residues), see Phobius details amino acids 173 to 198 (26 residues), see Phobius details PF00924: MS_channel_2nd" amino acids 190 to 258 (69 residues), 58 bits, see alignment E=4.1e-20

Best Hits

KEGG orthology group: None (inferred from 100% identity to bvu:BVU_0316)

Predicted SEED Role

"Small-conductance mechanosensitive channel"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See I9TWE0 at UniProt or InterPro

Protein Sequence (397 amino acids)

>HMPREF1058_RS02435 mechanosensitive ion channel (Phocaeicola vulgatus CL09T03C04)
MDTINNDLTNLLQQMGVHKESLGITQRIVIIAGILIIAFVADYFCRKIVVPTIKKLTART
QATWDDYLFNDAVLDNMCHLIPPIILYVLLPFAFPHEPVTLTFILKLCWVYITAVAMKLI
CSFLTSLYTISSEHEKLKNHPLKGVYQMIKLIVICVGVIIIVSTLIDKDPVNILTGLGAS
AAILMLVFKDTIMGLVAGVQLSANDMLRPGDWITMPKYGADGTVIEVTLTTVKVRNWDNT
ITTVPPYALVSDSFQNWRGMRESGGRRVKRSINIDMNTVRFCTPEQMKKFEKQVWMSGFE
KTGKEEVNLYVFRHYLEYYLRHNPRVNTELILMVRQLQPTPQGLPIELYFFSANKDWIPY
ERLQAEVFDHLLAVLPEFGLRVFQIPSGLDVLSLSSH