Protein Info for HMPREF1058_RS01485 in Phocaeicola vulgatus CL09T03C04

Annotation: ribonucleotide-diphosphate reductase subunit beta

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 349 transmembrane" amino acids 182 to 203 (22 residues), see Phobius details PF00268: Ribonuc_red_sm" amino acids 34 to 312 (279 residues), 305.8 bits, see alignment E=1.5e-95

Best Hits

Swiss-Prot: 72% identical to RIR2_TREPA: Ribonucleoside-diphosphate reductase subunit beta (nrdB) from Treponema pallidum (strain Nichols)

KEGG orthology group: K00526, ribonucleoside-diphosphate reductase beta chain [EC: 1.17.4.1] (inferred from 100% identity to bvu:BVU_3097)

Predicted SEED Role

"Ribonucleotide reductase of class Ia (aerobic), beta subunit (EC 1.17.4.1)" in subsystem Ribonucleotide reduction (EC 1.17.4.1)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 1.17.4.1

Use Curated BLAST to search for 1.17.4.1

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See I9IJM0 at UniProt or InterPro

Protein Sequence (349 amino acids)

>HMPREF1058_RS01485 ribonucleotide-diphosphate reductase subunit beta (Phocaeicola vulgatus CL09T03C04)
MNTIKLKKNALFNPEGDTDLRHRRMIGGNTTNLNDFNNMRYKWVSDWYRQAMNNFWIPEE
INLTQDTKDYPHLDQAERTAYDKILSFLVFLDSLQSNNLPTISEYITANEVNLCLHIQAF
QECVHSQSYSYMLDSICSPEKRNEILYQWKTDGHLLKRNTFIGNCYNEFQESQDGFTLMK
TLIANYILEGIYFYSGFMFFYNLSRNGKMSGSAQEIRYINRDENTHLWLFRNIILELKKE
EPDLFTPDKVKIYEYMMREGVKQEIEWGQYVIGDNIQGLNRKMIEDYIQYLGNLRWSSLG
FGPLYEENHKEPESMHWVSQYSNANMVKTDFFEAKSTAYAKSTALEDDL