Protein Info for HMPREF1058_RS01010 in Phocaeicola vulgatus CL09T03C04

Annotation: 4Fe-4S binding protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 25 55 PF00037: Fer4" amino acids 3 to 25 (23 residues), 33.1 bits, see alignment E=1.9e-11 amino acids 31 to 52 (22 residues), 37.9 bits, see alignment E=5.7e-13 PF13237: Fer4_10" amino acids 3 to 48 (46 residues), 33.9 bits, see alignment E=1.4e-11 PF12800: Fer4_4" amino acids 7 to 21 (15 residues), 21.2 bits, see alignment E=1.5e-07 amino acids 34 to 48 (15 residues), 21.1 bits, see alignment E=1.6e-07 PF13187: Fer4_9" amino acids 8 to 52 (45 residues), 39 bits, see alignment E=3.8e-13 PF12798: Fer4_3" amino acids 9 to 23 (15 residues), 16.3 bits, see alignment E=7.9e-06 amino acids 37 to 51 (15 residues), 19.6 bits, see alignment E=7.1e-07 PF12838: Fer4_7" amino acids 9 to 51 (43 residues), 37.6 bits, see alignment E=1.4e-12 PF12797: Fer4_2" amino acids 30 to 49 (20 residues), 27 bits, see alignment E=1.6e-09 PF12837: Fer4_6" amino acids 32 to 52 (21 residues), 28.4 bits, see alignment E=6.5e-10

Best Hits

Swiss-Prot: 69% identical to FER_BUTME: Ferredoxin from Butyribacterium methylotrophicum

KEGG orthology group: None (inferred from 93% identity to bsa:Bacsa_3014)

Predicted SEED Role

"Ferredoxin" in subsystem Soluble cytochromes and functionally related electron carriers

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See I8ZBQ4 at UniProt or InterPro

Protein Sequence (55 amino acids)

>HMPREF1058_RS01010 4Fe-4S binding protein (Phocaeicola vulgatus CL09T03C04)
MAYVISDDCIACGTCIDECPVEAISEGDKYSINPDLCTECGTCADACPSEAIHLG