Protein Info for HMPREF1058_RS00705 in Phocaeicola vulgatus CL09T03C04

Annotation: bifunctional ADP-dependent NAD(P)H-hydrate dehydratase/NAD(P)H-hydrate epimerase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 511 transmembrane" amino acids 247 to 266 (20 residues), see Phobius details TIGR00197: YjeF family N-terminal domain" amino acids 4 to 212 (209 residues), 120.5 bits, see alignment E=7.3e-39 PF03853: YjeF_N" amino acids 26 to 191 (166 residues), 164.4 bits, see alignment E=3.8e-52 TIGR00196: YjeF family C-terminal domain" amino acids 231 to 499 (269 residues), 220.6 bits, see alignment E=2.5e-69 PF01256: Carb_kinase" amino acids 252 to 495 (244 residues), 202.9 bits, see alignment E=8.6e-64 PF08543: Phos_pyr_kin" amino acids 368 to 463 (96 residues), 28.2 bits, see alignment E=1.8e-10

Best Hits

KEGG orthology group: None (inferred from 100% identity to bvu:BVU_1680)

Predicted SEED Role

"NAD(P)HX epimerase / NAD(P)HX dehydratase"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See I9TT79 at UniProt or InterPro

Protein Sequence (511 amino acids)

>HMPREF1058_RS00705 bifunctional ADP-dependent NAD(P)H-hydrate dehydratase/NAD(P)H-hydrate epimerase (Phocaeicola vulgatus CL09T03C04)
MKIISSTQLKELDKYTIAKEPVASIDLMERAAEELTRAITHRWDTSFHIVVFAGPGNNGG
DALAVARMLSKQNYHVEVFLFNTKGKLSEECQTNLERLKECGSVYFTEVSTQFDPPVLTE
RHLVVDGLFGSGLNKPLNGGFAAVVKYINASKAQVVAIDVPSGLMCEDNTYNIRQNMIRA
DVTLSIQLPKLSFLFPENEDIVGEWQLLDIQLKKDFIDTAQSPYYITEEEEIRSLIKPRK
RFAHKGAFGHALLIAGSYGMAGASILSARACLRSGVGLLTVHVPIHNHDLLQTTVPEAIV
QTDIHDHYFAEPVDTDRYQAIAIGPGLGQEEDTALAMMEQIQGCPVPLVLDADAINIFGT
HRNWLSRMPKRCILTPHLKELERLIGKCMDTYERLTKTKELAAYLQSYIIIKGSWSTVVT
PEGNCYFNPTGNPGMATAGSGDVLTGILAALLAQGYTQEDACRLGVYVHGLAGDIAAEEK
GEIGTTSSDLIDALPAAWKKLTETKGRFTKE