Protein Info for HMPREF1058_RS00555 in Phocaeicola vulgatus CL09T03C04

Annotation: anaerobic ribonucleoside-triphosphate reductase activating protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 152 TIGR02491: anaerobic ribonucleoside-triphosphate reductase activating protein" amino acids 6 to 151 (146 residues), 186 bits, see alignment E=2.1e-59 PF13353: Fer4_12" amino acids 12 to 149 (138 residues), 153.5 bits, see alignment E=4.6e-49 PF04055: Radical_SAM" amino acids 23 to 121 (99 residues), 44.7 bits, see alignment E=1.7e-15

Best Hits

KEGG orthology group: K04068, anaerobic ribonucleoside-triphosphate reductase activating protein [EC: 1.97.1.4] (inferred from 72% identity to bth:BT_1999)

Predicted SEED Role

"Ribonucleotide reductase of class III (anaerobic), activating protein (EC 1.97.1.4)" in subsystem Ribonucleotide reduction (EC 1.97.1.4)

Isozymes

Compare fitness of predicted isozymes for: 1.97.1.4

Use Curated BLAST to search for 1.97.1.4

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See I9TTA1 at UniProt or InterPro

Protein Sequence (152 amino acids)

>HMPREF1058_RS00555 anaerobic ribonucleoside-triphosphate reductase activating protein (Phocaeicola vulgatus CL09T03C04)
MNLLFTYPETIVDGEGIRYSIYLAGCRHHCRGCQNPESWNPSAGTPLTPEKIEKMICEIN
ANPLLDGITFSGGDPLYHPQEFLALVKQIKEATGQNIWCYTGYTFEQIQNDEMLKPILDY
VDVIVDGRFEPDLYSPYLEFRGSSNQRIIRVR