Protein Info for HMPREF1058_RS00500 in Phocaeicola vulgatus CL09T03C04

Annotation: nicotinate-nucleotide adenylyltransferase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF01467: CTP_transf_like
  • amino acids 10 to 168 (159 residues), 68.5 bits, E=3.4e-23
• TIGR00482: nicotinate (nicotinamide) nucleotide adenylyltransferase
  • amino acids 10 to 186 (177 residues), 154.7 bits, E=3e-49

Best Hits

Swiss-Prot: 100% identical to NADD_BACV8: Probable nicotinate-nucleotide adenylyltransferase (nadD) from Bacteroides vulgatus (strain ATCC 8482 / DSM 1447 / JCM 5826 / NBRC 14291 / NCTC 11154)

KEGG orthology group: K00969, nicotinate-nucleotide adenylyltransferase [EC: 2.7.7.18] (inferred from 100% identity to bvu:BVU_1643)

Predicted SEED Role

"Nicotinate-nucleotide adenylyltransferase (EC 2.7.7.18)" in subsystem NAD and NADP cofactor biosynthesis global or NAD regulation (EC 2.7.7.18)

MetaCyc Pathways

• NAD de novo biosynthesis I (6/6 steps found)
• NAD de novo biosynthesis III (6/6 steps found)
• NAD biosynthesis from 2-amino-3-carboxymuconate semialdehyde (4/4 steps found)
• aspartate superpathway (19/25 steps found)
• NAD de novo biosynthesis IV (anaerobic) (5/6 steps found)
• NAD salvage pathway II (PNC IV cycle) (4/5 steps found)
• NAD salvage pathway I (PNC VI cycle) (4/7 steps found)
• NAD salvage pathway V (PNC V cycle) (2/5 steps found)
• NAD de novo biosynthesis II (from tryptophan) (4/9 steps found)
• NAD salvage (plants) (4/11 steps found)
• superpathway of NAD biosynthesis in eukaryotes (5/14 steps found)

KEGG Metabolic Maps

• Nicotinate and nicotinamide metabolism

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.7.7.18

Sequence Analysis Tools

See I8ZD54 at UniProt or InterPro

Protein Sequence (190 amino acids)

>HMPREF1058_RS00500 nicotinate-nucleotide adenylyltransferase (Phocaeicola vulgatus CL09T03C04)
MEKSKIKTGIFGGSFNPIHMGHLALANYLCEYNGLDEIWFLVSPHNPLKQQTDLWDDNLR
LELVKLAIADYPKFRASDFEFHLSRPSYTIHTLDALHKAYPNREFTLIIGADNWLLFPRW
YKAEEILKNHHVMIYPRPNFTIDPTTLPPSVQLADTPLLEVSSTFIRQALAEGRDIRYFL
HPAVYERLKK