Protein Info for HMPREF1058_RS00480 in Phocaeicola vulgatus CL09T03C04
Annotation: 2-C-methyl-D-erythritol 2,4-cyclodiphosphate synthase
These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.
Protein Families and Features
Best Hits
Swiss-Prot: 99% identical to ISPF_BACV8: 2-C-methyl-D-erythritol 2,4-cyclodiphosphate synthase (ispF) from Bacteroides vulgatus (strain ATCC 8482 / DSM 1447 / JCM 5826 / NBRC 14291 / NCTC 11154)
KEGG orthology group: K01770, 2-C-methyl-D-erythritol 2,4-cyclodiphosphate synthase [EC: 4.6.1.12] (inferred from 99% identity to bvu:BVU_1639)MetaCyc: 54% identical to 2-C-methyl-D-erythritol 2,4-cyclodiphosphate synthase (Escherichia coli K-12 substr. MG1655)
2-C-methyl-D-erythritol 2,4-cyclodiphosphate synthase. [EC: 4.6.1.12]
Predicted SEED Role
"2-C-methyl-D-erythritol 2,4-cyclodiphosphate synthase (EC 4.6.1.12)" in subsystem Isoprenoid Biosynthesis or polyprenyl synthesis (EC 4.6.1.12)
MetaCyc Pathways
- methylerythritol phosphate pathway II (8/9 steps found)
- superpathway of geranylgeranyl diphosphate biosynthesis II (via MEP) (8/12 steps found)
- taxadiene biosynthesis (engineered) (8/13 steps found)
- methylerythritol phosphate pathway I (5/9 steps found)
- isoprene biosynthesis I (5/10 steps found)
- superpathway of ergosterol biosynthesis II (7/26 steps found)
KEGG Metabolic Maps
- Biosynthesis of alkaloids derived from terpenoid and polyketide
- Biosynthesis of plant hormones
- Biosynthesis of terpenoids and steroids
- Terpenoid biosynthesis
Isozymes
No predicted isozymesUse Curated BLAST to search for 4.6.1.12
Sequence Analysis Tools
PaperBLAST (search for papers about homologs of this protein)
Search CDD (the Conserved Domains Database, which includes COG and superfam)
Predict protein localization: PSORTb (Gram-negative bacteria)
Predict transmembrane helices and signal peptides: Phobius
Check the current SEED with FIGfam search
Find homologs in fast.genomics or the ENIGMA genome browser
See I9TTB2 at UniProt or InterPro
Protein Sequence (160 amino acids)
>HMPREF1058_RS00480 2-C-methyl-D-erythritol 2,4-cyclodiphosphate synthase (Phocaeicola vulgatus CL09T03C04) MKIRVGFGFDVHQLVTGRELWLGGIKFEHELGLLGHSDADVLIHAICDALLGAANMRDIG YHFPDTAGEFKNIDSKILLAETVDLIAAKGYKVGNVDATICAERPKLKARIPEMQLVLAH LMGIDVDDVSVKATTTEKLGFTGREEGISAYATVLIEKAE