Protein Info for HMPREF1058_RS00465 in Phocaeicola vulgatus CL09T03C04

Annotation: translation initiation factor

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 112 PF01253: SUI1" amino acids 36 to 108 (73 residues), 69.6 bits, see alignment E=1.3e-23

Best Hits

KEGG orthology group: K03113, translation initiation factor 1 (inferred from 99% identity to bvu:BVU_1636)

Predicted SEED Role

"Translation initiation factor SUI1-related protein" in subsystem Translation initiation factors eukaryotic and archaeal

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See I9IHQ9 at UniProt or InterPro

Protein Sequence (112 amino acids)

>HMPREF1058_RS00465 translation initiation factor (Phocaeicola vulgatus CL09T03C04)
MKNNDWKERLNVVYSTNPDFKYESVEEEAVETLDKKQQKLRVNIEKKGRGGKTVTLINGF
IGTENGLKELGKLLKSKCGVGGSVKDGEILIQGEFKQRVIELLKAEGYTQTK