Protein Info for HMPREF1058_RS00460 in Phocaeicola vulgatus CL09T03C04

Annotation: elongation factor Ts

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 329 TIGR00116: translation elongation factor Ts" amino acids 1 to 326 (326 residues), 203 bits, see alignment E=3e-64 PF00889: EF_TS" amino acids 70 to 215 (146 residues), 119.3 bits, see alignment E=8.9e-39 amino acids 215 to 326 (112 residues), 57.7 bits, see alignment E=6.3e-20

Best Hits

Swiss-Prot: 100% identical to EFTS_BACV8: Elongation factor Ts (tsf) from Bacteroides vulgatus (strain ATCC 8482 / DSM 1447 / JCM 5826 / NBRC 14291 / NCTC 11154)

KEGG orthology group: K02357, elongation factor Ts (inferred from 100% identity to bvu:BVU_1635)

Predicted SEED Role

"Translation elongation factor Ts"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See I8ZBJ3 at UniProt or InterPro

Protein Sequence (329 amino acids)

>HMPREF1058_RS00460 elongation factor Ts (Phocaeicola vulgatus CL09T03C04)
MAVTMAEITKLRKISGAGMMDCKNALTEANGDIDKAMEIIRKKGQAVAAKRSDREASEGC
VLAKKDGEFAAIIALKCETDFVAKNADFVALTQAILDAAVANRCKTLEEVKALPMGNGTV
QDAVTDRSGITGEKMELDGYNVVEGAYTSIYNHQGNNQLCTIVAMNKEAEAAAHGVAMQI
AAMNPIAIDEAGVPESVKEAEIQVAIDKTKKEQVDKAVEVALKKAGINPAHVDSEEHMES
NKAKGWITDEDIAKAKEIIATVSAEKAANLPQQMIENIAKGRLGKFLKEVCLLNQEDIMD
GKKTVREVLKEADPELQIVAFKRFTLRAE