Protein Info for HMPREF1058_RS00210 in Phocaeicola vulgatus CL09T03C04
Annotation: aspartate-semialdehyde dehydrogenase
These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.
Protein Families and Features
Best Hits
Swiss-Prot: 52% identical to DHAS_SYNY3: Aspartate-semialdehyde dehydrogenase (asd) from Synechocystis sp. (strain PCC 6803 / Kazusa)
KEGG orthology group: K00133, aspartate-semialdehyde dehydrogenase [EC: 1.2.1.11] (inferred from 100% identity to bvu:BVU_0205)MetaCyc: 50% identical to aspartate semialdehyde dehydrogenase subunit (Bacillus subtilis)
Aspartate-semialdehyde dehydrogenase. [EC: 1.2.1.11]
Predicted SEED Role
"Aspartate-semialdehyde dehydrogenase (EC 1.2.1.11)" in subsystem Lysine Biosynthesis DAP Pathway or Threonine and Homoserine Biosynthesis (EC 1.2.1.11)
MetaCyc Pathways
- superpathway of L-isoleucine biosynthesis I (12/13 steps found)
- L-lysine biosynthesis III (7/7 steps found)
- L-lysine biosynthesis VI (7/7 steps found)
- superpathway of L-lysine, L-threonine and L-methionine biosynthesis II (12/15 steps found)
- aspartate superpathway (19/25 steps found)
- L-homoserine biosynthesis (3/3 steps found)
- superpathway of L-threonine biosynthesis (5/6 steps found)
- superpathway of S-adenosyl-L-methionine biosynthesis (7/9 steps found)
- superpathway of L-methionine biosynthesis (transsulfuration) (7/9 steps found)
- superpathway of L-homoserine and L-methionine biosynthesis (6/8 steps found)
- dipicolinate biosynthesis (3/4 steps found)
- spermidine biosynthesis II (3/4 steps found)
- L-lysine biosynthesis I (6/9 steps found)
- L-lysine biosynthesis II (6/9 steps found)
- chorismate biosynthesis II (archaea) (8/12 steps found)
- superpathway of L-methionine biosynthesis (by sulfhydrylation) (8/12 steps found)
- L-methionine biosynthesis IV (2/4 steps found)
- superpathway of L-lysine, L-threonine and L-methionine biosynthesis I (12/18 steps found)
- ectoine biosynthesis (2/5 steps found)
- 3-dehydroquinate biosynthesis II (archaea) (3/7 steps found)
- norspermidine biosynthesis (2/6 steps found)
- superpathway of polyamine biosynthesis III (3/8 steps found)
- cremeomycin biosynthesis (2/7 steps found)
- grixazone biosynthesis (2/8 steps found)
- platensimycin biosynthesis (3/26 steps found)
KEGG Metabolic Maps
- Biosynthesis of alkaloids derived from ornithine, lysine and nicotinic acid
- Biosynthesis of plant hormones
- Glycine, serine and threonine metabolism
- Lysine biosynthesis
Isozymes
No predicted isozymesUse Curated BLAST to search for 1.2.1.11
Sequence Analysis Tools
PaperBLAST (search for papers about homologs of this protein)
Search CDD (the Conserved Domains Database, which includes COG and superfam)
Predict protein localization: PSORTb (Gram-negative bacteria)
Predict transmembrane helices and signal peptides: Phobius
Check the current SEED with FIGfam search
Find homologs in fast.genomics or the ENIGMA genome browser
See I9IH49 at UniProt or InterPro
Protein Sequence (336 amino acids)
>HMPREF1058_RS00210 aspartate-semialdehyde dehydrogenase (Phocaeicola vulgatus CL09T03C04) MKVAIVGASGAVGQEFLRVLDERNFPLDELVLFGSSRSAGRKYTFRGKQIEVKLLQHNDD FKGVDIAFTSAGAGTTKEFCETITKHGAVLIDNSSAYRMDADVPLVVPEVNPEDALNRPR NVIANPNCTTIQMVVALKAIENLSHIKRVHVATYQAASGAGAAAMDELYEQYRQVLANEP VTVEKFAYQLAFNLIPQIDVFTDNGYTKEEMKMFNETRKIMHSDIQVSAMCVRVPALRSH SESIWVETERPISPEEAREAFAKGEGLVLMDNPEKKEYPMPLFLAGKDPVYVGRIRKDLA NENGLTFWIVGDQIKKGAALNAVQIAEYLIKVGNVK