Protein Info for H281DRAFT_06600 in Paraburkholderia bryophila 376MFSha3.1

Annotation: putative spermidine/putrescine transport system permease protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 425 transmembrane" amino acids 33 to 56 (24 residues), see Phobius details amino acids 208 to 232 (25 residues), see Phobius details amino acids 243 to 266 (24 residues), see Phobius details amino acids 295 to 315 (21 residues), see Phobius details amino acids 349 to 371 (23 residues), see Phobius details amino acids 391 to 414 (24 residues), see Phobius details PF00528: BPD_transp_1" amino acids 226 to 419 (194 residues), 32.9 bits, see alignment E=2.7e-12

Best Hits

KEGG orthology group: None (inferred from 96% identity to bug:BC1001_4857)

Predicted SEED Role

"Spermidine Putrescine ABC transporter permease component PotB (TC 3.A.1.11.1)" in subsystem Polyamine Metabolism (TC 3.A.1.11.1)

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A2Z5MKV7 at UniProt or InterPro

Protein Sequence (425 amino acids)

>H281DRAFT_06600 putative spermidine/putrescine transport system permease protein (Paraburkholderia bryophila 376MFSha3.1)
VTTMTIAADSTPESTGRLKRELKAAEAKKRATALLLIAPLAIFLLLIFVVPIGALLTRAA
QNPEVVNALPHTLSALSTWDRKTPPPDTAYAALATDLTAIADSDGMGALARRLNVEVPGY
RSLIAKSARAMPFVDDNNKPLQLSPAQFHAKFAELDERWSNIAYWQAIAKNGSPYSPFYL
LASLDHKQDAFGHIIPTDPDQQIYLAVFSRTFVIGAAVTLFALLLGYPLAYWISTLPERR
ANLVMILVLIPFWTSILVRVAAWIVILQSEGLVNKALIGSGLLHDPLALLFNRTGVYISM
THILLPFMILPLYSVMKSIPPTYQRAAVSLGSHPFAAFWRVYVPQTYPGIGAGALLVFIL
AIGYYITPALLGGPNDQMVSYYVAYFTNVTINWGMACALGGLLLAATLVLYAIYGRFTRS
SLSLG