Protein Info for H281DRAFT_06523 in Paraburkholderia bryophila 376MFSha3.1

Annotation: protoporphyrin IX magnesium-chelatase (EC 6.6.1.1)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 360 PF20030: bpMoxR" amino acids 47 to 199 (153 residues), 30.7 bits, see alignment E=5.1e-11 PF00158: Sigma54_activat" amino acids 48 to 164 (117 residues), 24.4 bits, see alignment E=6.2e-09 PF00493: MCM" amino acids 49 to 171 (123 residues), 24.4 bits, see alignment E=4.4e-09 PF07728: AAA_5" amino acids 49 to 178 (130 residues), 47.3 bits, see alignment E=6.4e-16 PF01078: Mg_chelatase" amino acids 100 to 166 (67 residues), 30 bits, see alignment E=1e-10 PF17863: AAA_lid_2" amino acids 245 to 299 (55 residues), 47.8 bits, see alignment 3e-16

Best Hits

KEGG orthology group: K03405, magnesium chelatase subunit I [EC: 6.6.1.1] (inferred from 79% identity to bgf:BC1003_5845)

Predicted SEED Role

"ChlI component of cobalt chelatase involved in B12 biosynthesis" in subsystem Coenzyme B12 biosynthesis

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 6.6.1.1

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (360 amino acids)

>H281DRAFT_06523 protoporphyrin IX magnesium-chelatase (EC 6.6.1.1) (Paraburkholderia bryophila 376MFSha3.1)
MNAATQDARPNPAQNPAQRPAFPFSALIGQAPLQQALLLAAIDPGLGGVLVSGPRGTAKS
TAARALAELLPEGQLVNLPLGASEDRLIGTLDIETVLRDGSVRFSPGLLAKAHRGVLYVD
EVNLLPDALVDALLDVAASGVNTVERDGVSHSHEASFVLIGTMNPEEGELRPQLIDRFGL
MVELQNCFEPRVREEIVKARLAYDLDPVAFRAGYAREQADYVERIRAARNKLAQLSFDDA
VHAHVSALCIDAAVDGLRADLVMLRAARALAALEHSDAVTSQHVDSVAEAVLVHRRRQRD
TSTANDAAGGEAMSRDLPHSSTTPSSSDVEAGDGDWGYLPPQPSATTHVKGVTPLNVKKR