Protein Info for H281DRAFT_06498 in Paraburkholderia bryophila 376MFSha3.1

Annotation: Regulator of RNase E activity RraA

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF03737: RraA-like
  • amino acids 29 to 173 (145 residues), 161.7 bits, E=7.6e-52

Best Hits

Swiss-Prot: 34% identical to GALC_PSEPK: 4-carboxy-4-hydroxy-2-oxoadipic acid aldolase (galC) from Pseudomonas putida (strain ATCC 47054 / DSM 6125 / NCIMB 11950 / KT2440)

KEGG orthology group: None (inferred from 74% identity to reh:H16_B0348)

MetaCyc: 34% identical to subunit of 4-hydroxy-4-methyl-2-oxoglutarate aldolase (Pseudomonas putida)
4-hydroxy-4-methyl-2-oxoglutarate aldolase. [EC: 4.1.3.17]; 4.1.3.17 [EC: 4.1.3.17]

Predicted SEED Role

"Demethylmenaquinone methyltransferase"

MetaCyc Pathways

• gallate degradation I (4/4 steps found)
• methylgallate degradation (5/6 steps found)
• gallate degradation II (4/5 steps found)
• protocatechuate degradation I (meta-cleavage pathway) (6/8 steps found)
• superpathway of vanillin and vanillate degradation (7/10 steps found)
• 4-hydroxy-4-methyl-L-glutamate biosynthesis (1/2 steps found)
• syringate degradation (7/12 steps found)

KEGG Metabolic Maps

• Benzoate degradation via hydroxylation
• C5-Branched dibasic acid metabolism

Isozymes

Compare fitness of predicted isozymes for: 4.1.3.17

Use Curated BLAST to search for 4.1.3.17

Protein Sequence (227 amino acids)

>H281DRAFT_06498 Regulator of RNase E activity RraA (Paraburkholderia bryophila 376MFSha3.1)
MSKPNIVKDFERVSPELVKKASQFQPAILSDVNGRRGALHGRIKALYPRMKLAGPAFTVE
VRPGDNLMIHAALAVAKPGDVLVIDGKADQTCALMGTIMMHAARERGLAGVVLDAAVRDS
LDLDELDFPVFSVGTNPNGPTKEVGGRIGHPIACGGVTVNPGDFIIADADGVMCVEREKL
ESLLDKASEKVAWEARRIADIKEGKLNPPYLTQALITAGVIKEGETL