Protein Info for H281DRAFT_06488 in Paraburkholderia bryophila 376MFSha3.1

Annotation: EAL and modified HD-GYP domain-containing signal transduction protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 445 PF00563: EAL" amino acids 107 to 221 (115 residues), 62.2 bits, see alignment E=5.3e-21 PF08668: HDOD" amino acids 244 to 298 (55 residues), 33.1 bits, see alignment 4.1e-12

Best Hits

KEGG orthology group: K07181, putative signal transduction protein containing EAL and modified HD-GYP domains (inferred from 91% identity to bgf:BC1003_2149)

Predicted SEED Role

"Predicted signal transduction protein" in subsystem Flagellar motility

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A2Z5MBD6 at UniProt or InterPro

Protein Sequence (445 amino acids)

>H281DRAFT_06488 EAL and modified HD-GYP domain-containing signal transduction protein (Paraburkholderia bryophila 376MFSha3.1)
MSELHLVRATARRIEARDSSSEDADRASAPQFVYLGRQPILDRQGALNAYELLFRAGAHN
YAEITDDAQATAQVVARALGGIGVPAVLGRHRGFVNIDRAMLFDDIVHVMPPERFVLEIL
ETVKFDAQLARRLNELRRSGFQVALDDVSELSGELLAMLPHADIVKIDFLQTKRADLPEL
AAAMRGYGKTLLAEKVETREDFALARDLGFDLFQGYFFARPQVLAAPRNRSPRPSLLRLL
ALLSRDAGIVELEAELKLNPSVVVQLLRLVNSSAFGLGRNIASLREAIIATGTRQIARWA
QLLLYADSGDLPWRADPLVQLAGTRSRFMELAAGWMRPADDEFADAAFMTGIFSLVHVLL
GSTPKAVLEKLGLAPQIREAIVTHHGALGTLLRIAELAGKGGDAASIALEPDAPPEFAAL
TPEVLAELNLSAAAWFGAHVEEAAA