Protein Info for H281DRAFT_06460 in Paraburkholderia bryophila 376MFSha3.1

Annotation: diguanylate phosphodiesterase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 522 transmembrane" amino acids 12 to 31 (20 residues), see Phobius details amino acids 241 to 263 (23 residues), see Phobius details amino acids 370 to 386 (17 residues), see Phobius details PF12792: CSS-motif" amino acids 50 to 238 (189 residues), 97 bits, see alignment E=1.1e-31 PF00563: EAL" amino acids 270 to 500 (231 residues), 218.4 bits, see alignment E=9.9e-69

Best Hits

KEGG orthology group: None (inferred from 54% identity to bur:Bcep18194_B2992)

Predicted SEED Role

"diguanylate cyclase/phosphodiesterase (GGDEF & EAL domains) with PAS/PAC sensor(s)" in subsystem Bacterial hemoglobins

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (522 amino acids)

>H281DRAFT_06460 diguanylate phosphodiesterase (Paraburkholderia bryophila 376MFSha3.1)
MPDRIRRTSVRLPLFLCVVCGAAVMLVAILLSEHEAKVRVTEHEQLIGGDLVDSVDRILD
SVSTRRRNELAALAGKPCSSEVRASLAELETHLRYVRAVALVSGDRLYCSSALGPIDRPL
SDYPLSVGRGDSIGLLAQTPYQLGVPVLVIFNRPAPGTGVLSIVEGDYLADVLAHGVRYG
VQTASILVSDTGRINARGTFGPASGPLARYTTRVASHKWPFSILVSSSEGFISGMHWKYR
IPGLAVGLLVDGLIAAAYLLTFAPRRLLLNAVRQALRRNEFHVVYQPIIDTASRELVGVE
ALLRWHHPRWGAISPASFMEEVESSEMLGPVTQFVMKTAIAEMSQRAPAIPLRIAVNIAP
GDLERRGFVAQVVALTAGLPAGMTLVVELTERFLLAPSPRTATIFNALKARGVRFAIDDF
GTQHSNLDLLGRFQFDYVKIDRQFVNQVDTGGADLITGIVSVAKHYGLQVIAEGVETESQ
HAVLLAAGVPFAQGYLYQRPVKADQLAQRRQHDDATTSRIPV