Protein Info for H281DRAFT_06442 in Paraburkholderia bryophila 376MFSha3.1

Annotation: cytochrome d ubiquinol oxidase subunit II

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 328 transmembrane" amino acids 13 to 41 (29 residues), see Phobius details amino acids 62 to 82 (21 residues), see Phobius details amino acids 88 to 106 (19 residues), see Phobius details amino acids 122 to 142 (21 residues), see Phobius details amino acids 151 to 174 (24 residues), see Phobius details amino acids 190 to 209 (20 residues), see Phobius details amino acids 224 to 244 (21 residues), see Phobius details amino acids 255 to 277 (23 residues), see Phobius details amino acids 293 to 314 (22 residues), see Phobius details TIGR00203: cytochrome d ubiquinol oxidase, subunit II" amino acids 9 to 205 (197 residues), 117.7 bits, see alignment E=3.5e-38 PF02322: Cyt_bd_oxida_II" amino acids 10 to 319 (310 residues), 275.2 bits, see alignment E=3.9e-86

Best Hits

KEGG orthology group: K00426, cytochrome bd-I oxidase subunit II [EC: 1.10.3.-] (inferred from 62% identity to bgf:BC1003_3896)

Predicted SEED Role

"Cytochrome d ubiquinol oxidase subunit II (EC 1.10.3.-)" in subsystem Bacterial RNA-metabolizing Zn-dependent hydrolases or Conserved gene cluster associated with Met-tRNA formyltransferase or Terminal cytochrome d ubiquinol oxidases or Terminal cytochrome oxidases (EC 1.10.3.-)

Isozymes

Compare fitness of predicted isozymes for: 1.10.3.-

Use Curated BLAST to search for 1.10.3.-

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (328 amino acids)

>H281DRAFT_06442 cytochrome d ubiquinol oxidase subunit II (Paraburkholderia bryophila 376MFSha3.1)
MTPASTQDLLNHAWFGLIGLMLLLYVVTDGFDLGVGILTLLRSREADRDLMIQSIGHVWD
ANETWLVALGGALFGAFPQAYAMILSDLYVPVMVLIASFIMRGAAIEFRHAAHTSKTAWD
RVFGLGSLLAAVSQGIVLGKLLTGFVPGLANTGFVAITAVGVVSGYCLLGATWLVKKTTG
SMESSSRRQAIIAVFTTVIAALIVSFGTLKQSPVGITRWQEHGVFHLLIALAVLAALAFV
YVLYSVHMRGEHGPFFGATLLFMFSFAGLAISLFPYIVPGQLTVAEAASDSATLTFMLFG
IGIVFPIMVGYNLYQYHLFRGKVVAIKH