Protein Info for H281DRAFT_06433 in Paraburkholderia bryophila 376MFSha3.1

Annotation: cytochrome bd-I ubiquinol oxidase subunit 2 apoprotein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 335 transmembrane" amino acids 6 to 37 (32 residues), see Phobius details amino acids 58 to 77 (20 residues), see Phobius details amino acids 83 to 101 (19 residues), see Phobius details amino acids 114 to 137 (24 residues), see Phobius details amino acids 157 to 180 (24 residues), see Phobius details amino acids 196 to 217 (22 residues), see Phobius details amino acids 229 to 247 (19 residues), see Phobius details amino acids 259 to 280 (22 residues), see Phobius details amino acids 298 to 318 (21 residues), see Phobius details PF02322: Cyt_bd_oxida_II" amino acids 5 to 323 (319 residues), 328.1 bits, see alignment E=3e-102 TIGR00203: cytochrome d ubiquinol oxidase, subunit II" amino acids 6 to 214 (209 residues), 139 bits, see alignment E=1.2e-44

Best Hits

KEGG orthology group: K00426, cytochrome bd-I oxidase subunit II [EC: 1.10.3.-] (inferred from 98% identity to bpy:Bphyt_5725)

MetaCyc: 59% identical to cyanide insensitive ubiquinol oxidase subunit II (Pseudomonas putida KT2440)
RXN-6883 [EC: 1.10.3.11]

Predicted SEED Role

"putative Cytochrome bd2, subunit II" in subsystem Terminal cytochrome d ubiquinol oxidases or Terminal cytochrome oxidases

MetaCyc Pathways

Isozymes

Compare fitness of predicted isozymes for: 1.10.3.-

Use Curated BLAST to search for 1.10.3.- or 1.10.3.11

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (335 amino acids)

>H281DRAFT_06433 cytochrome bd-I ubiquinol oxidase subunit 2 apoprotein (Paraburkholderia bryophila 376MFSha3.1)
MQIDLPVVWAFIIGLGVFIYVMLDGFDLGIGLLFPFFEEKADRHVMLNTVAPVWDGNETF
LVLGGAGLYGAFPVVYSTLLPANYMPLILMVVGLIFRGAAFELRAKAKRTQHAWDLAFIG
GSALAALCQGITLGSLLQGIKIVDSRFVGDPFDWLSPFSLFCGIGVLMTYATLGCGWLIL
KTDGELQRKMRELMRPLVIALLATIGIVSLWTVIGLPAVEKRWFGSGQLGWFLPVPILVV
LCVWGILRSVRLQHEAMPFLLTLAICFLGYTGLVISIWPYIIPPSLTIWDASSSHSSQLF
ALVGTAIVLPVILVYNAMQYRVFRGKVREGDPGYH