Protein Info for H281DRAFT_06416 in Paraburkholderia bryophila 376MFSha3.1

Annotation: Zn-dependent alcohol dehydrogenases, class III

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF00107: ADH_zinc_N
  • amino acids 28 to 131 (104 residues), 70.8 bits, E=1.1e-23
• PF13602: ADH_zinc_N_2
  • amino acids 34 to 165 (132 residues), 28.1 bits, E=3.7e-10

Predicted SEED Role

"S-(hydroxymethyl)glutathione dehydrogenase (EC 1.1.1.284)" in subsystem Glutathione-dependent pathway of formaldehyde detoxification (EC 1.1.1.284)

MetaCyc Pathways

• formaldehyde oxidation II (glutathione-dependent) (3/3 steps found)
• protein S-nitrosylation and denitrosylation (3/5 steps found)
• superpathway of C1 compounds oxidation to CO₂ (8/12 steps found)

KEGG Metabolic Maps

• Methane metabolism

Isozymes

Compare fitness of predicted isozymes for: 1.1.1.284

Use Curated BLAST to search for 1.1.1.284

Protein Sequence (175 amino acids)

>H281DRAFT_06416 Zn-dependent alcohol dehydrogenases, class III (Paraburkholderia bryophila 376MFSha3.1)
VTESICQHVTEPREKGLNICWKLIVVVRLAKKFGVTHFINPNEVENVVDHIVQLTDGGAD
YSFECIGNTKVMRQALECTHKGWGQSFIIGVAAAGEEISTRPFQLVTGREWKGSAFGGAR
GRTDVPKIVDWYMEGKINIDDLITHRLPLERINEGFDLMKKGESIRSVVLYQATR