Protein Info for H281DRAFT_06414 in Paraburkholderia bryophila 376MFSha3.1

Annotation: EamA domain-containing membrane protein RarD

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 290 transmembrane" amino acids 15 to 34 (20 residues), see Phobius details amino acids 43 to 63 (21 residues), see Phobius details amino acids 75 to 96 (22 residues), see Phobius details amino acids 102 to 124 (23 residues), see Phobius details amino acids 131 to 150 (20 residues), see Phobius details amino acids 156 to 174 (19 residues), see Phobius details amino acids 184 to 203 (20 residues), see Phobius details amino acids 215 to 236 (22 residues), see Phobius details amino acids 244 to 263 (20 residues), see Phobius details amino acids 269 to 288 (20 residues), see Phobius details PF00892: EamA" amino acids 16 to 146 (131 residues), 54.5 bits, see alignment E=7.1e-19 amino acids 160 to 281 (122 residues), 37.4 bits, see alignment E=1.3e-13

Best Hits

KEGG orthology group: None (inferred from 33% identity to bbt:BBta_0424)

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (290 amino acids)

>H281DRAFT_06414 EamA domain-containing membrane protein RarD (Paraburkholderia bryophila 376MFSha3.1)
VSESMSVAAAPKQSVGVAFYVFAIFLLAAMDASAKWLTKGYPIGEIAFFRAVFAFAPLIV
AQARERKSLELRSKVWPLHLLRGALVMGTVVTFFFSVKELPLATVTAISLANPFFMVLCS
ALLLKEAVSTLRWVLILLGFVGVLVAIGGVSLTASLFTAVAVLSALLYALAAVLTKHLAR
TESAVLIAAYTNVSMLVLSLFSLSPSWTLPGWHDFLLFALMGLAGGLSNYVFTLAFRFAE
VSTVAPIEYTILVWAALFGFFLFSEIPTTLTIVGALIIVVSGIANARLRR