Protein Info for H281DRAFT_06384 in Paraburkholderia bryophila 376MFSha3.1

Annotation: hypothetical protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 352 transmembrane" amino acids 12 to 31 (20 residues), see Phobius details amino acids 50 to 64 (15 residues), see Phobius details amino acids 76 to 95 (20 residues), see Phobius details amino acids 115 to 136 (22 residues), see Phobius details amino acids 146 to 168 (23 residues), see Phobius details amino acids 173 to 192 (20 residues), see Phobius details amino acids 233 to 252 (20 residues), see Phobius details amino acids 264 to 283 (20 residues), see Phobius details amino acids 291 to 313 (23 residues), see Phobius details amino acids 327 to 351 (25 residues), see Phobius details PF03773: ArsP_1" amino acids 76 to 346 (271 residues), 92.7 bits, see alignment E=1.2e-30

Best Hits

KEGG orthology group: K07089, (no description) (inferred from 94% identity to bpy:Bphyt_6565)

Predicted SEED Role

"Transporter"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A2Z5MMF0 at UniProt or InterPro

Protein Sequence (352 amino acids)

>H281DRAFT_06384 hypothetical protein (Paraburkholderia bryophila 376MFSha3.1)
MQSTLRQPRVALGWIVFLAIAVVGLFYVKWFPYYNRAFVAASQHSIGKSILMGTSASAPA
ASWQSAIDYAFAYGKAIWQAMVLGLLLGSAVQALIPPQWVARALGRSDFSSVVKGGLMSL
PGMMCTCCAAPVVAGLRARQAAPGAAIAFWLGNTALNPATLIFMGFVLGWQWMGLRLALG
LVMVFGLGYLVNRMVTPKEAEASREAIAQLVTTDEPGTAFTRWVKILGTMTLRLVPEYIV
LVLILGAARAWLFPHVGPDIDNSVLWIVALSIAGTLFVIPTAGEVPIIQAMLSFGVAAGP
AGALLMTLPLISVPSMAMLGRSFPKRVLTVVALAVVVCGIVSGLLAASLGFR