Protein Info for H281DRAFT_06374 in Paraburkholderia bryophila 376MFSha3.1

Annotation: ATP-binding cassette, subfamily B

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 609 transmembrane" amino acids 44 to 66 (23 residues), see Phobius details amino acids 86 to 107 (22 residues), see Phobius details amino acids 161 to 182 (22 residues), see Phobius details amino acids 187 to 206 (20 residues), see Phobius details amino acids 271 to 294 (24 residues), see Phobius details PF00664: ABC_membrane" amino acids 48 to 307 (260 residues), 62.5 bits, see alignment E=5.3e-21 PF00005: ABC_tran" amino acids 380 to 529 (150 residues), 110.6 bits, see alignment E=1e-35

Best Hits

KEGG orthology group: None (inferred from 90% identity to bgf:BC1003_4372)

Predicted SEED Role

"Transport ATP-binding protein CydCD" in subsystem Terminal cytochrome d ubiquinol oxidases or Terminal cytochrome oxidases

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A2Z5MMG0 at UniProt or InterPro

Protein Sequence (609 amino acids)

>H281DRAFT_06374 ATP-binding cassette, subfamily B (Paraburkholderia bryophila 376MFSha3.1)
MELVDRSDRSRASRVRGRRRSRVLSRYAGRPVRLIWRYVARHKVAHVIMLVSVVAAVGFA
LASQYGIRNLIDALPQGRAHPQTVEYAFAVLVGLIFADNLMWRVAGWVAARAFVRVTGDI
RQDMFEYLTGHAPSFFADKQPGVLSSRVSATANAVYIIENTVAWTALPPTLTVIGAIVMV
ATVSVPMSVALVAVSAALSACLFWLARKGTSRHEAFASQAASVDGELVDVIGNMGLVRAF
SAVNAEQRRFDGHLEAEAVARKRSLLYLEKLRLLHAFATVVLSAGVLGWTVWLWTQGRAS
TGDVVLVGSLGFSILHGSRDVAVAFVDLTQHVARLAEASQTLLTPYSMPEPPKAIPLAVR
EATVDFDNVSFAYPGRRPVLNELTLHIQAGERVGLVGPSGAGKSTVLALLQHFYEPATGC
VRISGQDISQVTLESLQAAISVVPQDVTLLHRSLLDNIRYGCPDASEADVRRACEDASCM
DFIGALPDGLNTIAGDRGAKLSGGQRQRVAIARAILKDSPILLLDEATSALDTASEIVIQ
AALERLMQNRTVIAIAHRLSTLQSFDRIIVMNRGRVVQEGTPAQLAQVPGIYRDTLARHG
RRTPAPTLN