Protein Info for H281DRAFT_06370 in Paraburkholderia bryophila 376MFSha3.1

Annotation: tight adherence protein C

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 318 transmembrane" amino acids 6 to 30 (25 residues), see Phobius details amino acids 100 to 122 (23 residues), see Phobius details amino acids 132 to 154 (23 residues), see Phobius details amino acids 280 to 308 (29 residues), see Phobius details PF00482: T2SSF" amino acids 173 to 301 (129 residues), 74.4 bits, see alignment E=4.2e-25

Best Hits

KEGG orthology group: K12511, tight adherence protein C (inferred from 87% identity to bug:BC1001_5119)

Predicted SEED Role

"Type II/IV secretion system protein TadC, associated with Flp pilus assembly" in subsystem Widespread colonization island

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (318 amino acids)

>H281DRAFT_06370 tight adherence protein C (Paraburkholderia bryophila 376MFSha3.1)
METLDSGTLLLLGGVFVATFAGVVALMWWMTPKDMQRRIQQAGGVSISRQTQSSAGSGWA
EKIAEISRPISQLSIPKDGWEDSPLRLRLMNAGWRSSTAAGLYFAAKTVLALLLPLVGLV
ALMRTPVVNGQYAVSATILAILAAIGYYTPNIILARCRVRRQRAIVEGFPDALDLLTVCV
EAGLGMDAALMRVANEMQLASPEVASELQLMLLELRSGFTKEKALRNLALRTGVEDVDNF
ASMLVQADRFGTSIGASLRVMSDTLRTRRRMRAEERAAKIALKLLFPLIFCIFPALMTVL
MGPAFIHIYRILLPTLGT