Protein Info for H281DRAFT_06328 in Paraburkholderia bryophila 376MFSha3.1

Annotation: transcriptional regulator, propionate catabolism operon regulatory protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 650 700 729 signal peptide" amino acids 1 to 24 (24 residues), see Phobius details TIGR02329: propionate catabolism operon regulatory protein PrpR" amino acids 68 to 727 (660 residues), 778.1 bits, see alignment E=2.1e-238 PF06506: PrpR_N" amino acids 93 to 256 (164 residues), 167.9 bits, see alignment E=7e-53 PF00989: PAS" amino acids 262 to 311 (50 residues), 22.7 bits, see alignment 3.8e-08 PF08448: PAS_4" amino acids 267 to 315 (49 residues), 30.2 bits, see alignment 2e-10 PF00158: Sigma54_activat" amino acids 384 to 551 (168 residues), 231 bits, see alignment E=3e-72 PF14532: Sigma54_activ_2" amino acids 385 to 556 (172 residues), 72.1 bits, see alignment E=2.6e-23 PF07728: AAA_5" amino acids 408 to 527 (120 residues), 31.9 bits, see alignment E=5.7e-11 PF02954: HTH_8" amino acids 690 to 726 (37 residues), 36.1 bits, see alignment 2e-12

Best Hits

KEGG orthology group: K02688, transcriptional regulator, propionate catabolism operon regulatory protein (inferred from 87% identity to bpy:Bphyt_6082)

Predicted SEED Role

"Propionate catabolism operon regulatory protein PrpR" in subsystem Methylcitrate cycle

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (729 amino acids)

>H281DRAFT_06328 transcriptional regulator, propionate catabolism operon regulatory protein (Paraburkholderia bryophila 376MFSha3.1)
MQRSGHALRRALSACFGGDPAFCEMPMISLMKLANFIFEMDARIMTASSQPRAHRATAVS
TPPFDPVQRPRIWALSISRLRDLFFDIAGEYVERADLRIVAQGFEDAVREIEAAGASRPD
VVIAGGSNGAYLKTRVAVPVVMITPTGFDVMHALARARRDGSKVALVTHGNTPDEVRRFV
TAFGLDVTFASHQSAQDAESVVLDLRDRGVDVVVGPGLVTDLAANAGMGAVFLYSRASVR
AGFDTALEVAQATRRETIRRQRLDNLLQHLRDGVVALDSQGRVEAMNQRLAAVLGIDPAN
AVGRTFLELAPDLDGSLPDSDGDAFCTVRGASYVVHRGPLATSGAAAGTVLTFQESRAVE
RLDRTLRSRQRVQQFSARYRLEDMVGASESMQRVRALVQRYARSDATVLILGESGTGKEM
VAQSMHHLSARRDFAFVAINCGAFPEALLESELFGYEEGAFTGARKGGKAGLIEVAHRGT
LFLDEIGEMPLSLQSRLLRVLQEREVVRLGSTEPTRVDIRVVAATHRALTAGIEAGTFRA
DLYYRLNILSIALPPLRERPTDLISLAVELLLQAAAREPRLAARLPDAAAAERVLAGLAE
PLQRYAWPGNVRELQNVVERIAVELAEIETETDVGLHADAAAQTSPSRNAAIAQPLITRD
MLRTIAPEITEPHHTRSKKASLTLRERSRHVEADEIRAALAAHGGDRDAVCDALGISKTT
LWRKLNAPR