Protein Info for H281DRAFT_06324 in Paraburkholderia bryophila 376MFSha3.1

Annotation: glutamate-5-semialdehyde dehydrogenase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 423 PF00171: Aldedh" amino acids 12 to 289 (278 residues), 55.3 bits, see alignment E=2.2e-19 amino acids 312 to 385 (74 residues), 36.3 bits, see alignment E=1.3e-13 TIGR00407: glutamate-5-semialdehyde dehydrogenase" amino acids 14 to 412 (399 residues), 494.3 bits, see alignment E=1.2e-152

Best Hits

Swiss-Prot: 96% identical to PROA_PARPJ: Gamma-glutamyl phosphate reductase (proA) from Paraburkholderia phytofirmans (strain DSM 17436 / LMG 22146 / PsJN)

KEGG orthology group: K00147, glutamate-5-semialdehyde dehydrogenase [EC: 1.2.1.41] (inferred from 96% identity to bxe:Bxe_A0579)

MetaCyc: 46% identical to glutamate-5-semialdehyde dehydrogenase (Escherichia coli K-12 substr. MG1655)
Glutamate-5-semialdehyde dehydrogenase. [EC: 1.2.1.41]

Predicted SEED Role

"Gamma-glutamyl phosphate reductase (EC 1.2.1.41)" in subsystem Proline Synthesis (EC 1.2.1.41)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 1.2.1.41

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A2Z5MF46 at UniProt or InterPro

Protein Sequence (423 amino acids)

>H281DRAFT_06324 glutamate-5-semialdehyde dehydrogenase (Paraburkholderia bryophila 376MFSha3.1)
MDIDQYMTDLGRRARQASRAMARASTAAKNAALAAVAAGIERDAALLKEANARDLARARD
KGHDAAFIDRLTLSDKALKTMVEGLRQVAALADPIGEISNLKYRPSGIQVGQMRVPLGVI
GIIYESRPNVTIDAAALCLKSGNATILRGGSEALECNTALAKLIGEGLEAAGLPQDAVQV
VATADRAAVGKLITMTEYVDVIVPRGGKSLIERLMNEARVPMIKHLDGICHVYVDDRADL
AKALTVCDNAKTHRYGTCNTMETLLVARGIASTVLPPLGKLYREKEVELRVDAAARAVLA
GAGVGPLVDATEDDWRTEYLAPVLAIKVVDDLDAAIEHINTYSSQHTDAIVTEDHDRAMR
FLREVDSASVMVNASTRFADGFEFGLGAEIGISNDKLHARGPVGLEGLTSLKYVVLGHGE
GRQ