Protein Info for H281DRAFT_06318 in Paraburkholderia bryophila 376MFSha3.1

Annotation: dihydrodipicolinate reductase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 265 PF01113: DapB_N" amino acids 1 to 123 (123 residues), 136.5 bits, see alignment E=5.4e-44 TIGR00036: 4-hydroxy-tetrahydrodipicolinate reductase" amino acids 1 to 263 (263 residues), 321.7 bits, see alignment E=2.1e-100 PF05173: DapB_C" amino acids 126 to 262 (137 residues), 161.8 bits, see alignment E=8.5e-52

Best Hits

Swiss-Prot: 84% identical to DAPB_PARP8: 4-hydroxy-tetrahydrodipicolinate reductase (dapB) from Paraburkholderia phymatum (strain DSM 17167 / CIP 108236 / LMG 21445 / STM815)

KEGG orthology group: K00215, dihydrodipicolinate reductase [EC: 1.3.1.26] (inferred from 97% identity to bgf:BC1003_2963)

MetaCyc: 60% identical to 4-hydroxy-tetrahydrodipicolinate reductase (Escherichia coli K-12 substr. MG1655)
RXN-14014 [EC: 1.17.1.8]

Predicted SEED Role

"4-hydroxy-tetrahydrodipicolinate reductase (EC 1.17.1.8)" (EC 1.17.1.8)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 1.17.1.8 or 1.3.1.26

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A2Z5MDS4 at UniProt or InterPro

Protein Sequence (265 amino acids)

>H281DRAFT_06318 dihydrodipicolinate reductase (Paraburkholderia bryophila 376MFSha3.1)
MKIAIAGASGRMGRMLIETVLNDSDATLSGALDRAGSPQLGQDAGAFLGKQTGVMLTDDI
ERVFAESDYLIDFTRPEGTLMHLEAAQRHNVKMVIGTTGFDNEQKAQLRAAADNIAIMFA
SNMSVGVNVTLKLLEYAAKHFATGYDIEIIEAHHRHKVDAPSGTALTMGEVIANALGRNL
DDCAVYSREGVTGERDPSTIGFSAIRGGDIVGDHTVLFAGIGERIEITHKSASRLSYAQG
ALRAVRFLEGHQTGFFDMQDVLGLR