Protein Info for H281DRAFT_06300 in Paraburkholderia bryophila 376MFSha3.1

Annotation: NAD(P)-dependent dehydrogenase, short-chain alcohol dehydrogenase family

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 266 PF00106: adh_short" amino acids 26 to 215 (190 residues), 158 bits, see alignment E=4.3e-50 PF08659: KR" amino acids 26 to 183 (158 residues), 41.5 bits, see alignment E=2.9e-14 PF01370: Epimerase" amino acids 27 to 97 (71 residues), 21.8 bits, see alignment E=2.3e-08 PF13561: adh_short_C2" amino acids 33 to 265 (233 residues), 178.9 bits, see alignment E=2.5e-56

Best Hits

Swiss-Prot: 49% identical to SQD_PSEPU: Sulfoquinovose 1-dehydrogenase (PpSQ1_00405) from Pseudomonas putida

KEGG orthology group: None (inferred from 96% identity to bgf:BC1003_2982)

Predicted SEED Role

"Putative oxidoreductase in arabinose utilization cluster" in subsystem L-Arabinose utilization

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A2Z5MG92 at UniProt or InterPro

Protein Sequence (266 amino acids)

>H281DRAFT_06300 NAD(P)-dependent dehydrogenase, short-chain alcohol dehydrogenase family (Paraburkholderia bryophila 376MFSha3.1)
MSSPANANERLANSAFARYPSLVDRTVLITGGATGIGASFVEHFAAQGARVAFFDIDATA
GEALADELGDSKHKPLFLPCDLTDVDALQKAIADVKAALGPIQALVNNAANDKRHTIGEV
TRESFDAGIAVNIRHQFFAAQAVMEDMKAANSGSIINLGSISWMLKNGGYPVYVMSKSAV
QGLTRGLARDLGHFNIRVNTLVPGWVMTEKQKRLWLDDAGRRAIKEGQCIDAELMPDDLA
RMALFLAADDSRMITAQDIVVDGGWA