Protein Info for H281DRAFT_06298 in Paraburkholderia bryophila 376MFSha3.1

Annotation: L-arabinose ABC transporter ATP-binding protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 519 PF00005: ABC_tran" amino acids 27 to 176 (150 residues), 114.5 bits, see alignment E=6e-37 amino acids 278 to 432 (155 residues), 66.3 bits, see alignment E=4.7e-22

Best Hits

Swiss-Prot: 95% identical to ARAG_PARXL: Arabinose import ATP-binding protein AraG (araG) from Paraburkholderia xenovorans (strain LB400)

KEGG orthology group: K10539, L-arabinose transport system ATP-binding protein [EC: 3.6.3.17] (inferred from 97% identity to bgf:BC1003_2984)

Predicted SEED Role

"L-arabinose transport ATP-binding protein AraG (TC 3.A.1.2.2)" in subsystem L-Arabinose utilization (TC 3.A.1.2.2)

Isozymes

Compare fitness of predicted isozymes for: 3.6.3.17

Use Curated BLAST to search for 3.6.3.17

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A2Z5MHD0 at UniProt or InterPro

Protein Sequence (519 amino acids)

>H281DRAFT_06298 L-arabinose ABC transporter ATP-binding protein (Paraburkholderia bryophila 376MFSha3.1)
MKQRGGEVSATLRFDNIGKVFPGVRALDGVSFDVNVGQVHGLMGENGAGKSTLLKILGGE
YQPDSGRVMIDGKEVRFTSAASSIAAGIAVIHQELQYVPDLTVAENLLLGQLPNSFGWVN
KRDAKRFVRERLEAMGVALDPNAKLRKLSIAQRQMVEICKALLRNARVIALDEPTSSLSH
RETEVLFKLVRDLRADNRAMIYISHRMDEIYELCDACTIFRDGRKIASHPTLEGVSRDTI
VSEMVGREISDIYNYSERPLGEVRFAAKAIEGHALSQPASFEVRRGEIVGFFGLVGAGRS
ELMHLVYGTEHKKGGELVLDGKTIRVKSAGEAIRHGIVLCPEDRKEEGIVAMATVSENIN
ISCRRHYLRAGVFLDRKKEAETADRFIKLLKIKTPSRRQKIRFLSGGNQQKAILSRWLAE
PDLKVVILDEPTRGIDVGAKHEIYNVIYQLAERGCAIVMISSELPEVLGVSDRIVVMRQG
RIAGELSRKDATEQAVLSLALPQSSTALPATGTAAQQAA