Protein Info for H281DRAFT_06297 in Paraburkholderia bryophila 376MFSha3.1

Annotation: L-arabinose-binding protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 332 signal peptide" amino acids 1 to 26 (26 residues), see Phobius details PF00532: Peripla_BP_1" amino acids 30 to 305 (276 residues), 146.7 bits, see alignment E=1.1e-46 PF13407: Peripla_BP_4" amino acids 31 to 299 (269 residues), 79.9 bits, see alignment E=2.3e-26

Best Hits

Swiss-Prot: 50% identical to ARAF_AZOBR: ABC transporter L-arabinose-binding periplasmic protein (araF) from Azospirillum brasilense

KEGG orthology group: K10537, L-arabinose transport system substrate-binding protein (inferred from 99% identity to bug:BC1001_3051)

MetaCyc: 47% identical to arabinose ABC transporter periplasmic binding protein (Escherichia coli K-12 substr. MG1655)
ABC-2-RXN [EC: 7.5.2.12, 7.5.2.13]

Predicted SEED Role

"L-arabinose-binding periplasmic protein precursor AraF (TC 3.A.1.2.2)" in subsystem L-Arabinose utilization (TC 3.A.1.2.2)

Isozymes

No predicted isozymes

Use Curated BLAST to search for 7.5.2.12 or 7.5.2.13

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A2Z5MFL9 at UniProt or InterPro

Protein Sequence (332 amino acids)

>H281DRAFT_06297 L-arabinose-binding protein (Paraburkholderia bryophila 376MFSha3.1)
MKRRIFLTLAAAAAGVVFNAPVAQAADPVKIGFLVKQPEEPWFQDEWKFAEIAAKEKGFT
LVKIGAPSGEKVMSAIDNLSAQKAQGFVICTPDVKLGPGIVAKAKADGLKMMTVDDRLVD
GAGKPIASVPHMGISAYNIGKQVGDGLAAEIKKRGWDMKDVGAIDVTYEQLPTAHDRTSG
ATDALLAAGFPKANVIAAPQAKTDTENAFNAANIALTKNPQFKHWVAYALNDEGVLGAVR
AAEGRGFKADNMIGIGIGGSDSALNEFKKPNPTGFFGTVIISPKRHGEETATLMYDWITQ
GKAPPPLTLTTGMLATRENVGEVREKMGLASK