Protein Info for H281DRAFT_06293 in Paraburkholderia bryophila 376MFSha3.1

Annotation: transcriptional regulator, IclR family

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 326 PF09339: HTH_IclR" amino acids 70 to 118 (49 residues), 31.1 bits, see alignment 1.7e-11 PF01614: IclR" amino acids 183 to 310 (128 residues), 72.4 bits, see alignment E=3.3e-24

Best Hits

KEGG orthology group: None (inferred from 94% identity to bug:BC1001_3055)

Predicted SEED Role

"D-galactonate regulator, IclR family" in subsystem D-galactonate catabolism

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A2Z5ME41 at UniProt or InterPro

Protein Sequence (326 amino acids)

>H281DRAFT_06293 transcriptional regulator, IclR family (Paraburkholderia bryophila 376MFSha3.1)
MNKAMPNHAESAAEAELAPHADHDASSATPRTAPAAKAPRATPQPAAVVNGIALPSTLLD
ITPQQAGTQTLLRGLAILEAAAAGVRDLRTFGAALGTTRSTTHRLVSSLVQARYLRQVQG
GYLLGPKLIELGTIALEQMPLTAVARPHLESLAEQTLDTIHLGVRDGDDVLYIDKIPGTR
GLEMRSRVGHRMPLASTGIGKAMMLDLTPEHWQSLFDASRRALASVTFKPDNRPDAQTFM
QRMTNYAAGGYTFDLEENEASIRCVAAPVRDASGAIVAALSVASTIPYMSLERMDELIPV
VQREARAISEELGWRAPQPTTRRIKR