Protein Info for H281DRAFT_06275 in Paraburkholderia bryophila 376MFSha3.1

Annotation: ribonucleoside-diphosphate reductase beta chain

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF00268: Ribonuc_red_sm
  • amino acids 94 to 381 (288 residues), 310.9 bits, E=4.2e-97

Best Hits

Swiss-Prot: 60% identical to RIR2_CHLMU: Ribonucleoside-diphosphate reductase subunit beta (nrdB) from Chlamydia muridarum (strain MoPn / Nigg)

KEGG orthology group: K00526, ribonucleoside-diphosphate reductase beta chain [EC: 1.17.4.1] (inferred from 98% identity to bgf:BC1003_3021)

MetaCyc: 59% identical to ribonucleotide reductase beta subunit (Chlamydia trachomatis)
Ribonucleoside-diphosphate reductase. [EC: 1.17.4.1]; 1.17.4.1 [EC: 1.17.4.1]

Predicted SEED Role

"Ribonucleotide reductase of class Ia (aerobic), beta subunit (EC 1.17.4.1)" in subsystem Ribonucleotide reduction (EC 1.17.4.1)

MetaCyc Pathways

• superpathway of histidine, purine, and pyrimidine biosynthesis (44/46 steps found)
• superpathway of purine nucleotides de novo biosynthesis I (21/21 steps found)
• superpathway of purine nucleotides de novo biosynthesis II (24/26 steps found)
• superpathway of pyrimidine deoxyribonucleotides de novo biosynthesis (18/18 steps found)
• pyrimidine deoxyribonucleotides de novo biosynthesis I (9/9 steps found)
• superpathway of purine nucleotide salvage (12/14 steps found)
• superpathway of pyrimidine deoxyribonucleotides de novo biosynthesis (E. coli) (12/14 steps found)
• superpathway of guanosine nucleotides de novo biosynthesis I (6/6 steps found)
• pyrimidine deoxyribonucleotides de novo biosynthesis III (8/9 steps found)
• superpathway of adenosine nucleotides de novo biosynthesis I (5/5 steps found)
• superpathway of guanosine nucleotides de novo biosynthesis II (7/8 steps found)
• pyrimidine deoxyribonucleotides de novo biosynthesis IV (6/7 steps found)
• superpathway of adenosine nucleotides de novo biosynthesis II (6/7 steps found)
• adenosine deoxyribonucleotides de novo biosynthesis I (2/2 steps found)
• guanosine deoxyribonucleotides de novo biosynthesis I (2/2 steps found)
• pyrimidine deoxyribonucleotides biosynthesis from CTP (6/8 steps found)
• adenosine deoxyribonucleotides de novo biosynthesis II (3/4 steps found)
• guanosine deoxyribonucleotides de novo biosynthesis II (3/4 steps found)

KEGG Metabolic Maps

• Glutathione metabolism
• Purine metabolism
• Pyrimidine metabolism

Isozymes

Compare fitness of predicted isozymes for: 1.17.4.1

Use Curated BLAST to search for 1.17.4.1

Sequence Analysis Tools

See A0A2Z5MI91 at UniProt or InterPro

Protein Sequence (414 amino acids)

>H281DRAFT_06275 ribonucleoside-diphosphate reductase beta chain (Paraburkholderia bryophila 376MFSha3.1)
MVTFMLNWDDEITAVTPSSATQPNVLRNAAGPAVGSQVGTRSAPHAPSAQDIFANDIAVA
PAATVAHAAGTAAVSEARVNVADKRIINGQTDVNQLVPFKYKWAWEKYLAGCANHWMPQE
VNMSRDIALWKDPNGLTEDERRIVKRNLGFFVTADSLAANNIVLGTYRHITAPECRQFLL
RQAFEEAIHTHAYQYIVESLGLDEGEIFNAYHEVSSIRAKDEFLIPYINVLTDPGFQTGT
LETDQTLLRSLIVFACVMEGLFFYVGFTQILALGRQNKMTGAAEQYQYILRDESMHCNFG
IDLINQIKLENPQLWTAEFRAEIREIFQQAVELEYRYAEDTMPRGVLGLNASMFKSYLRF
ICNRRCQQIGLDPLYPNEENPFPWMSEMIDLKKERNFFETRVIEYQTGGALTWE