Protein Info for H281DRAFT_06271 in Paraburkholderia bryophila 376MFSha3.1

Annotation: ABC-type uncharacterized transport system, permease component

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 317 transmembrane" amino acids 6 to 23 (18 residues), see Phobius details amino acids 69 to 87 (19 residues), see Phobius details amino acids 93 to 113 (21 residues), see Phobius details amino acids 125 to 145 (21 residues), see Phobius details amino acids 159 to 182 (24 residues), see Phobius details amino acids 222 to 244 (23 residues), see Phobius details amino acids 257 to 275 (19 residues), see Phobius details amino acids 287 to 308 (22 residues), see Phobius details PF01578: Cytochrom_C_asm" amino acids 73 to 311 (239 residues), 90.7 bits, see alignment E=5.4e-30

Best Hits

KEGG orthology group: None (inferred from 93% identity to bug:BC1001_3078)

Predicted SEED Role

"FIG001154: CcsA-related protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A2Z5MEI1 at UniProt or InterPro

Protein Sequence (317 amino acids)

>H281DRAFT_06271 ABC-type uncharacterized transport system, permease component (Paraburkholderia bryophila 376MFSha3.1)
MDIVLYALTALLYGGLAVAGWRSHRHAGSRPMLESVPPMPAAATTGANTQAQSGFAGSAA
SGMSSSGRALLFVALLAHGVLLHTTIFPQNAMVFGFAFALSAMFWLGAGIYWIESFFFPL
DGLRLLVLPLACVASLLPLAFNGVRVLPYSAAPMFKLHFLIANIAYGLFAIAALHAILML
LVERRLHAMRGGIAQRNVAAAGNGWLSSWLDTLPPLLTLEKLLFRLIGAGFVLLTLTLVS
GILFSEQLVDRALRLDHKTVFAILSWVMFGALLTARKVSGWRGRAALRWVLASFVALLLA
YVGSRFVFEVLLHRAVV