Protein Info for H281DRAFT_06270 in Paraburkholderia bryophila 376MFSha3.1

Annotation: signal recognition particle subunit FFH/SRP54 (srp54)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 455 TIGR00959: signal recognition particle protein" amino acids 3 to 434 (432 residues), 569.8 bits, see alignment E=1.8e-175 PF02881: SRP54_N" amino acids 5 to 82 (78 residues), 65.2 bits, see alignment E=1.3e-21 PF06414: Zeta_toxin" amino acids 103 to 147 (45 residues), 22.6 bits, see alignment 1.5e-08 PF00448: SRP54" amino acids 104 to 300 (197 residues), 239 bits, see alignment E=9.1e-75 PF02978: SRP_SPB" amino acids 332 to 432 (101 residues), 110.3 bits, see alignment E=1.2e-35

Best Hits

KEGG orthology group: K03106, signal recognition particle subunit SRP54 (inferred from 99% identity to bgf:BC1003_3026)

Predicted SEED Role

"Signal recognition particle, subunit Ffh SRP54 (TC 3.A.5.1.1)" in subsystem Two cell division clusters relating to chromosome partitioning or Universal GTPases (TC 3.A.5.1.1)

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A2Z5MF96 at UniProt or InterPro

Protein Sequence (455 amino acids)

>H281DRAFT_06270 signal recognition particle subunit FFH/SRP54 (srp54) (Paraburkholderia bryophila 376MFSha3.1)
MLDNLTQRMARVVKTLRGEARLTEANTQEMLREVRLALLEADVALPVVREFIAKVKEKAL
GEEVISSLSPGQALVGVVQRELTAVIGGDYEGKAAELNLAVTPPAVILMAGLQGAGKTTT
VGKLAKLLREKYKKKVLTVSCDVYRPAAIAQLKTVTEQVGADFFPSEPDQKPVDIARAAV
DWARRHYHDVLLVDTAGRLGIDEAMMQEITALHTTLKPAETLFVVDAMLGQDAVNTAKAF
SDALPLTGVVLTKLDGDSRGGAALSVRHVTGKPIKFVGVAEKLDGLEVFYPDRMANRILG
MGDILALVEEAQRGVDVQAAQKLADKVKKGGDFDLNDFRAQLTQMKGMGGLSSLMDKLPA
QFQQAAAGADMSQAEKQMRRMEGIINSMTPLERAKPDLIKATRKRRIAAGAGVQVQEVNR
MLNQYDQMRTMMKKLKGGNLQKMMRGMKGMLPGMR