Protein Info for H281DRAFT_06256 in Paraburkholderia bryophila 376MFSha3.1

Annotation: type IV pilus assembly protein PilC

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 409 transmembrane" amino acids 175 to 197 (23 residues), see Phobius details amino acids 226 to 247 (22 residues), see Phobius details amino acids 260 to 280 (21 residues), see Phobius details amino acids 382 to 403 (22 residues), see Phobius details PF00482: T2SSF" amino acids 73 to 198 (126 residues), 100.6 bits, see alignment E=3.2e-33 amino acids 279 to 401 (123 residues), 88 bits, see alignment E=2.5e-29

Best Hits

Swiss-Prot: 41% identical to PILC_PSEAE: Type 4 fimbrial assembly protein PilC (pilC) from Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)

KEGG orthology group: K02653, type IV pilus assembly protein PilC (inferred from 87% identity to bgf:BC1003_3039)

Predicted SEED Role

"Type IV fimbrial assembly protein PilC" in subsystem Type IV pilus

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A2Z5MG96 at UniProt or InterPro

Protein Sequence (409 amino acids)

>H281DRAFT_06256 type IV pilus assembly protein PilC (Paraburkholderia bryophila 376MFSha3.1)
VTNTVTRRPASTDTRFRWHGVDPDGNHRTGLLIAPDAGTARALLKRDKLFVVDLKADGPA
PRPKANTADVTLFTRQLASLLRAGLPLAPALDLLGQAQSSRRPGMPRIVGALARDITAGL
RFSAALQQHPLQFNALYCQLVEVGEAAGALPAVLARIADDRERAAAQRAKVRAALTYPVV
ILLLALAITAALLVWVVPTFKQIFDGFGARLPAPTQFVLALSSGAAQWSVPAIAVIVAAY
FAATFLLRRSETARIRFARLSLKIPVAGSLLATLCAARWSRALGTLLSAGTPLADAFDSL
THATGNAFFDRATVDIAARLRRGERLAAAMRSASCFPQDVVQPVAVAEESGALDTMLLDV
ASLADRQVDEKIGTLSSLCEPLVIVVLGALVGGLVIAMYLPIIQLGNVV