Protein Info for H281DRAFT_06226 in Paraburkholderia bryophila 376MFSha3.1

Annotation: long-chain acyl-CoA synthetase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF00501: AMP-binding
  • amino acids 29 to 421 (393 residues), 302 bits, E=5.7e-94
• PF13193: AMP-binding_C
  • amino acids 472 to 546 (75 residues), 63.1 bits, E=3.9e-21

Best Hits

Swiss-Prot: 57% identical to LCFA_YERPE: Long-chain-fatty-acid--CoA ligase (fadD) from Yersinia pestis

KEGG orthology group: K01897, long-chain acyl-CoA synthetase [EC: 6.2.1.3] (inferred from 94% identity to bpy:Bphyt_3482)

Predicted SEED Role

No annotation

MetaCyc Pathways

• superpathway of fatty acids biosynthesis (E. coli) (50/53 steps found)
• palmitate biosynthesis III (28/29 steps found)
• superpathway of fatty acid biosynthesis II (plant) (38/43 steps found)
• palmitate biosynthesis II (type II fatty acid synthase) (29/31 steps found)
• oleate β-oxidation (29/35 steps found)
• fatty acid salvage (5/6 steps found)
• stearate biosynthesis II (bacteria and plants) (5/6 steps found)
• octane oxidation (4/5 steps found)
• long-chain fatty acid activation (1/1 steps found)
• phytol degradation (3/4 steps found)
• stearate biosynthesis IV (4/6 steps found)
• γ-linolenate biosynthesis II (animals) (1/2 steps found)
• linoleate biosynthesis II (animals) (1/2 steps found)
• capsaicin biosynthesis (4/7 steps found)
• alkane biosynthesis II (1/3 steps found)
• oleate biosynthesis I (plants) (1/3 steps found)
• 3-methyl-branched fatty acid α-oxidation (3/6 steps found)
• 6-gingerol analog biosynthesis (engineered) (3/6 steps found)
• long chain fatty acid ester synthesis (engineered) (1/4 steps found)
• phosphatidylcholine acyl editing (1/4 steps found)
• wax esters biosynthesis II (1/4 steps found)
• ceramide degradation by α-oxidation (2/7 steps found)
• sphingosine and sphingosine-1-phosphate metabolism (4/10 steps found)
• stearate biosynthesis I (animals) (1/6 steps found)
• arachidonate biosynthesis III (6-desaturase, mammals) (1/7 steps found)
• icosapentaenoate biosynthesis II (6-desaturase, mammals) (1/7 steps found)
• icosapentaenoate biosynthesis III (8-desaturase, mammals) (1/7 steps found)
• ceramide and sphingolipid recycling and degradation (yeast) (4/16 steps found)
• sporopollenin precursors biosynthesis (4/18 steps found)
• cutin biosynthesis (1/16 steps found)
• suberin monomers biosynthesis (3/20 steps found)

KEGG Metabolic Maps

• Fatty acid metabolism

Isozymes

Compare fitness of predicted isozymes for: 6.2.1.3

Use Curated BLAST to search for 6.2.1.3

Sequence Analysis Tools

See A0A2Z5MFU1 at UniProt or InterPro

Protein Sequence (557 amino acids)

>H281DRAFT_06226 long-chain acyl-CoA synthetase (Paraburkholderia bryophila 376MFSha3.1)
MDKIWLKSYPPGVPAEIDPTRYSSVAELLEEAFREHRNKPAFVCMGKEISYGELDALSRK
LAAWFQSKGLARGARVAIMMPNVLQYPVAIAAILRAGYVVVNVNPLYTPRELEHQLKDSG
AEAIVLLENFAVTLQAVVRNTAVKHIVVAAMGDLMGVKGAVVNFVVRQVKKMVPAWSLPG
HVKFNTAIAEGERQTFKPVQQGPDDVAFLQYTGGTTGVAKGATLLHRNLIANVLQSEIWL
NPVRTDRTDIEQFITVVALPLYHVFALTVCGLLTIRTGGLGVLIPNPRDIPGMIKALQGY
AITTIPAVNTLYNALLNNPDFHKLDFSKLIAANGGGMAVQEAVAKRWFENTHTPIIEGYG
LSETSPCVTCNPVTVTEYSGTIGLPLPSTEVSIRDDEGNEVPLGQPGEICIRGPQVMAGY
WNRPDETAKVMTSDGFFRSGDVGFMNEQGFVKIVDRKKDMILVSGFNVYPNEIEDVVARL
PGVFEVAAVGVPDQHSGEAVKLFVVRKDDALTDADIFAYCKQQLTGYKRPKIVEFRTELP
KSNVGKILRRELRDGRA