Protein Info for H281DRAFT_06224 in Paraburkholderia bryophila 376MFSha3.1

Annotation: hippurate hydrolase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 326 TIGR01891: amidohydrolase" amino acids 1 to 305 (305 residues), 305 bits, see alignment E=3.8e-95 PF01546: Peptidase_M20" amino acids 1 to 315 (315 residues), 158.1 bits, see alignment E=3e-50 PF07687: M20_dimer" amino acids 109 to 207 (99 residues), 46.1 bits, see alignment E=4.4e-16

Best Hits

KEGG orthology group: K01451, hippurate hydrolase [EC: 3.5.1.32] (inferred from 93% identity to bgf:BC1003_3070)

Predicted SEED Role

"Catalyzes the cleavage of p-aminobenzoyl-glutamate to p-aminobenzoate and glutamate, subunit A" in subsystem p-Aminobenzoyl-Glutamate Utilization

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 3.5.1.32

Use Curated BLAST to search for 3.5.1.32

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A2Z5ME12 at UniProt or InterPro

Protein Sequence (326 amino acids)

>H281DRAFT_06224 hippurate hydrolase (Paraburkholderia bryophila 376MFSha3.1)
MDALPIQELNSFEHKSKNDGKMHACGHDGHTAMLLGAARHLAKHGEFDGTIVFIFQPAEE
GGAGAQAMIDDGLFEKFPVDAVFGIHNWPGMPAGKFGVTEGPIMASSNEFRIEIKGVGSH
AALPHNGRDPVFTAVQIANGLQSIITRNKKPLDTAVLSITQIHAGDAVNVVPNDAWLAGT
VRTFTTETLDLIEARMRKIVENTAEAYDCSAKVHFHRNYPPTINSGDEARFAASVMKEIV
GAENVDDSVEPTMGAEDFSFMLLAKPGCYAFLGNGDGGHRDAGHGAGPCMLHNASYDFND
ELLPIGSTYWVRLAQRFLAGNDTTDR