Protein Info for H281DRAFT_06203 in Paraburkholderia bryophila 376MFSha3.1

Annotation: PAS domain S-box-containing protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 518 TIGR00229: PAS domain S-box protein" amino acids 14 to 130 (117 residues), 32.8 bits, see alignment E=3.4e-12 PF13426: PAS_9" amino acids 20 to 116 (97 residues), 31 bits, see alignment E=5.1e-11 PF00512: HisKA" amino acids 158 to 223 (66 residues), 56.3 bits, see alignment E=5.5e-19 PF02518: HATPase_c" amino acids 270 to 381 (112 residues), 87.9 bits, see alignment E=1.3e-28 PF00072: Response_reg" amino acids 405 to 514 (110 residues), 72 bits, see alignment E=8.8e-24

Best Hits

Predicted SEED Role

"Chemotaxis protein methyltransferase CheR (EC 2.1.1.80)" in subsystem Bacterial Chemotaxis (EC 2.1.1.80)

Isozymes

Compare fitness of predicted isozymes for: 2.1.1.80

Use Curated BLAST to search for 2.1.1.80

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (518 amino acids)

>H281DRAFT_06203 PAS domain S-box-containing protein (Paraburkholderia bryophila 376MFSha3.1)
MHPPPATNGPVDDAYEYAPCGLLRTEPDGIIVRVNATFCRWLGFKATDLLGRRRIQDLLT
MGGRVFHQTHWAPLLQMQRSVAEVKLEFRHRDGHKVAMLINAVRRSSDEAAFDDFACIIV
HDRHKYEKELVYARRRTEEALEAKIEAEEALRLANRHKDEFLATLAHELRNPLAPIQAAL
NFLSRKEFAEPDVRLSFGVLERQVAQIGRLVDDLLDVARIAEGKIELRIQRIDLIPMLNT
AIEGSRELLRSKSDEFVADLPDRPIYIDADPARVVQIAQNLLNNAAKYTPPGGRIGLTVS
WDDTHAIIAVSDTGIGISAENLPALFSIFSQLPSGKSYAQGGLGIGLSLVRALSEAHGGA
ATATSLGASRGSEFTVRLPLAPVQETAVKDERMMLAAAPGSRRRVLVVDDSEDAVFSLCM
LLESDGFETRSASTGNGAISMASKADVVLLDIGLPDMDGYDVARQIRADPRNSGVLLVAV
TGWSQNRDREAAAGAGFDHHLTKPVDYARLLEILNTAG