Protein Info for H281DRAFT_06080 in Paraburkholderia bryophila 376MFSha3.1

Annotation: thioredoxin reductase (NADPH)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 411 PF07992: Pyr_redox_2" amino acids 86 to 397 (312 residues), 111.7 bits, see alignment E=1.2e-35 PF13738: Pyr_redox_3" amino acids 184 to 349 (166 residues), 38.7 bits, see alignment E=1.8e-13 PF00070: Pyr_redox" amino acids 231 to 305 (75 residues), 28.7 bits, see alignment E=3.8e-10

Best Hits

KEGG orthology group: K00384, thioredoxin reductase (NADPH) [EC: 1.8.1.9] (inferred from 92% identity to bpy:Bphyt_5494)

Predicted SEED Role

"Thioredoxin reductase (EC 1.8.1.9)" in subsystem Glycine reductase, sarcosine reductase and betaine reductase or Thioredoxin-disulfide reductase or Wyeosine-MimG Biosynthesis (EC 1.8.1.9)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 1.8.1.9

Use Curated BLAST to search for 1.8.1.9

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A2Z5MKY5 at UniProt or InterPro

Protein Sequence (411 amino acids)

>H281DRAFT_06080 thioredoxin reductase (NADPH) (Paraburkholderia bryophila 376MFSha3.1)
MVRIYGPMRSANGYAIRDFLHRSDIPFEWIELRSDKEAEELAHVQHLSDSRLPVCVFHDG
TRLECPTIRQITEKLGWFASPSREAYDLAIYGAGPAGLSAAVYGASEGLQTVLVERWALG
GQAGSSSKIENYLGFPQGLSGAELAERARVQAVKFGAEILLARAGVHAEFPPGRGIVSLE
DGTRITARTSICATGVAYRTLALAGEERFLGAGLYYGAGASEAELIDGEDVYVVGGGNSA
GQAAMHFSQSANRVYMVVRATSLKNTLSHYLVDRITSAPNIEVRTCTEVTALAGGDVLEE
VTLTDIRTGRQSTVKTNWLFVCIGGVPQTEWAQEVGIVRDEGGYLVTGPDLQEYRAHFNW
PLERAPLHLETSMPGVFAAGDVRHASIKRVASAVGEGAMAVALVHRYLTSA