Protein Info for H281DRAFT_06069 in Paraburkholderia bryophila 376MFSha3.1

Annotation: tRNA pseudouridine38-40 synthase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 272 TIGR00071: tRNA pseudouridine(38-40) synthase" amino acids 3 to 239 (237 residues), 225.3 bits, see alignment E=4e-71 PF01416: PseudoU_synth_1" amino acids 8 to 104 (97 residues), 46.7 bits, see alignment E=2e-16 amino acids 143 to 245 (103 residues), 112.5 bits, see alignment E=7.2e-37

Best Hits

Swiss-Prot: 90% identical to TRUA_PARXL: tRNA pseudouridine synthase A (truA) from Paraburkholderia xenovorans (strain LB400)

KEGG orthology group: K06173, tRNA pseudouridine synthase A [EC: 5.4.99.12] (inferred from 92% identity to bug:BC1001_4902)

MetaCyc: 46% identical to tRNA pseudouridine38-40 synthase (Escherichia coli K-12 substr. MG1655)
tRNA-pseudouridine synthase I. [EC: 5.4.99.12]

Predicted SEED Role

"tRNA pseudouridine synthase A (EC 4.2.1.70)" in subsystem tRNA processing (EC 4.2.1.70)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 4.2.1.70, 5.4.99.12

Use Curated BLAST to search for 4.2.1.70 or 5.4.99.12

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A2Z5MKM5 at UniProt or InterPro

Protein Sequence (272 amino acids)

>H281DRAFT_06069 tRNA pseudouridine38-40 synthase (Paraburkholderia bryophila 376MFSha3.1)
VKRIALGVQYDGSAFCGWQSQPHGNTVQDELEKALREFAQTPVHTVVAGRTDTGVHGLGQ
VVHFDTELDRADISWIRGTNSFLPKTISVQWAKPMPEAFHARFSAFERTYHYLLYVHPVR
SPMLAARAGWVHTSLDIDAMRAAATLLIGEHDFSAFRSSQCQAKTPVKHLYQIDIQQQGD
FIHFRFRANAFLHHMVRNLMGCLVYVGKGRRPVAWMAEVLASRDREWAAPTFMPDGLYLA
QVGYPEHFAVPAPQTGSVPWSTVWNEQAHHEL