Protein Info for H281DRAFT_06068 in Paraburkholderia bryophila 376MFSha3.1

Annotation: phosphoribosylanthranilate isomerase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 241 PF00697: PRAI" amino acids 31 to 233 (203 residues), 145 bits, see alignment E=1.2e-46

Best Hits

Swiss-Prot: 62% identical to TRPF_RALPJ: N-(5'-phosphoribosyl)anthranilate isomerase (trpF) from Ralstonia pickettii (strain 12J)

KEGG orthology group: K01817, phosphoribosylanthranilate isomerase [EC: 5.3.1.24] (inferred from 88% identity to bug:BC1001_4903)

Predicted SEED Role

"Phosphoribosylanthranilate isomerase (EC 5.3.1.24)" in subsystem Auxin biosynthesis or Tryptophan synthesis (EC 5.3.1.24)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 5.3.1.24

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A2Z5MKX1 at UniProt or InterPro

Protein Sequence (241 amino acids)

>H281DRAFT_06068 phosphoribosylanthranilate isomerase (Paraburkholderia bryophila 376MFSha3.1)
MNFENHGTDSLANEAGAAAPEQGIPRRTRIKLCGLSKPADVNCAIDLGADAIGLVFYPPS
PRSVSVAQAVELVHQVPPFVSVVGLFVNPTPDWMREVVSNVGLSLLQFHGDETADQCESL
AGVAGLPWLRALRVAADTQPADLVKSALNYSAASGFLFDTHVEGYGGGGKVFDWSLIPAE
LARRAVLSGGLNAQNVSDAIHRVRPYAVDVSSGIEVPGARGVKDHARMAAFVRAVRAADA
G