Protein Info for H281DRAFT_06036 in Paraburkholderia bryophila 376MFSha3.1

Annotation: Membrane-associated phospholipid phosphatase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 244 transmembrane" amino acids 20 to 43 (24 residues), see Phobius details amino acids 55 to 76 (22 residues), see Phobius details amino acids 88 to 108 (21 residues), see Phobius details amino acids 116 to 137 (22 residues), see Phobius details amino acids 144 to 163 (20 residues), see Phobius details amino acids 170 to 189 (20 residues), see Phobius details PF01569: PAP2" amino acids 85 to 165 (81 residues), 43.8 bits, see alignment E=1.1e-15

Best Hits

KEGG orthology group: None (inferred from 90% identity to bug:BC1001_4935)

Predicted SEED Role

"Membrane-associated phospholipid phosphatase"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (244 amino acids)

>H281DRAFT_06036 Membrane-associated phospholipid phosphatase (Paraburkholderia bryophila 376MFSha3.1)
MILCGSDRLFSMPDLPAQLWYSITSLGGAGMTLPLAFAIALWLGVGYTWRMAAGWLLLLG
AAIGVVTVTKLAFLGWGVGVREFDFTGVSGHAMLSTAVYPVALFLMLLRTRPPVRVLGVV
LGLAAGMAVGLSRVVLSAHSPSEAITGCLVGALAALLFVRTAWNAVPERLSVLPVAVSLM
ALAVLMHGVHVPTQRWVTHIALKVSGHDRPFIRAKWKAVRDVRPAAAPLSQTRNSLAPPR
SLNA