Protein Info for H281DRAFT_06035 in Paraburkholderia bryophila 376MFSha3.1

Annotation: esterase, PHB depolymerase family

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 396 transmembrane" amino acids 201 to 219 (19 residues), see Phobius details PF10503: Esterase_PHB" amino acids 103 to 320 (218 residues), 301.6 bits, see alignment E=1e-93 PF00756: Esterase" amino acids 106 to 235 (130 residues), 30.7 bits, see alignment E=9.7e-11 TIGR01840: esterase, PHB depolymerase family" amino acids 107 to 299 (193 residues), 145.5 bits, see alignment E=8.1e-47 PF00561: Abhydrolase_1" amino acids 119 to 235 (117 residues), 36.9 bits, see alignment E=1.1e-12 PF00326: Peptidase_S9" amino acids 139 to 296 (158 residues), 48 bits, see alignment E=4e-16 PF03959: FSH1" amino acids 157 to 300 (144 residues), 23.1 bits, see alignment E=1.9e-08

Best Hits

KEGG orthology group: None (inferred from 90% identity to bug:BC1001_4936)

Predicted SEED Role

"Poly(3-hydroxybutyrate) depolymerase"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A2Z5MMX6 at UniProt or InterPro

Protein Sequence (396 amino acids)

>H281DRAFT_06035 esterase, PHB depolymerase family (Paraburkholderia bryophila 376MFSha3.1)
MAKSLSKIWLRGLKRLLAIQTEHAHTTAKRATKRPTRAASSKPSTKVRPLKSAALRSPVK
REAPHAAARESRVRPRAAAWASGSWTRSFHSAPAAPGRLVNHLQYGLYVPSGHALEAMPL
LVMLHGCTQSIDEFAQGTRMNVLADRYGFAVVYPEQSKHAHSHRCWHWYDAGESAGGAEA
RAVVSLVDALVAQHGFDSERVYVAGISAGAGLAALLALRFPDRFAAVALHSGPAFGEARS
GITAMDVMRRGARRDPAELVDEVADVAHYPGMPALIIHGDADHVVAPVNADQLATQFLRL
NRMIDPKGARKSGEMREERKGGMTLRDYFRSGRRVVRVCHVQGVAHAWSGGDDSVPFHSA
KGPDASAMVWEFFKHQRRVGAGVAESTAADASAYAR