Protein Info for H281DRAFT_06008 in Paraburkholderia bryophila 376MFSha3.1

Annotation: RNA polymerase, sigma 70 subunit, RpoD

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 650 700 744 PF03979: Sigma70_r1_1" amino acids 125 to 204 (80 residues), 96.6 bits, see alignment E=2.1e-31 PF00140: Sigma70_r1_2" amino acids 221 to 252 (32 residues), 48.9 bits, see alignment (E = 1.6e-16) PF04546: Sigma70_ner" amino acids 262 to 478 (217 residues), 216.5 bits, see alignment E=1.2e-67 TIGR02393: RNA polymerase sigma factor RpoD" amino acids 505 to 741 (237 residues), 393.8 bits, see alignment E=2.8e-122 TIGR02937: RNA polymerase sigma factor, sigma-70 family" amino acids 505 to 730 (226 residues), 132 bits, see alignment E=1.6e-42 PF04542: Sigma70_r2" amino acids 511 to 579 (69 residues), 80.2 bits, see alignment E=2.3e-26 PF04539: Sigma70_r3" amino acids 588 to 664 (77 residues), 89.5 bits, see alignment E=3.7e-29 PF04545: Sigma70_r4" amino acids 677 to 730 (54 residues), 66.9 bits, see alignment 2.6e-22

Best Hits

Swiss-Prot: 60% identical to RPOD_NEIGO: RNA polymerase sigma factor RpoD (rpoD) from Neisseria gonorrhoeae

KEGG orthology group: K03086, RNA polymerase primary sigma factor (inferred from 94% identity to bgf:BC1003_4533)

Predicted SEED Role

"RNA polymerase sigma factor RpoD" in subsystem Flagellum or Macromolecular synthesis operon or Transcription factors cyanobacterial RpoD-like sigma factors or Transcription initiation, bacterial sigma factors

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A2Z5MKZ1 at UniProt or InterPro

Protein Sequence (744 amino acids)

>H281DRAFT_06008 RNA polymerase, sigma 70 subunit, RpoD (Paraburkholderia bryophila 376MFSha3.1)
MAKAVAKAAKTVPPPAAKRPGVRSAREAAVAQDDAAVRETPVSTVQPAVVHQPRVETTAG
TANSMTKKLNEVPVDDDATQSEETPVAASGKVEKAKARDRRAKEKALLKDAFSSSAPGTV
EELEERRSKLRALIKLGKERGFLTYAEINDHLPDNFTETEAIEGIISTFNDMGVAVYEQA
PDAETLLLNDNAPAASSDDEVEEEAEVALSTVDSEFGRTTDPVRMYMREMGTVELLTREG
EIEIAKRIEDGLKHMVMAISACPTTIADILAMAERVANEEIRIDELVDGLIDADAEDADG
FSVQEAEAIESEDDEAEEEDEEDEEEDDGTAQATANAAQMEALKRASLEKFALISEWFDK
MRRAFEKEGYKSKSYLKAQETIQNELMTIRFTARTVERLCDTLRAQVDEVRQVERQILHT
VVDKCGMPRAEFIARFPGSETDLEWADKIVSEGHAYSAILTRNIPAIREQQQRLLDLQAR
VVLPLKDLKETNRQMAAGELKARQAKREMTEANLRLVISIAKKYTNRGLQFLDLIQEGNI
GLMKAVDKFEYRRGYKFSTYATWWIRQAITRSIADQARTIRIPVHMIETINKMNRISRQI
LQETGLEPDPATLAEKMEMPEDKIRKIMKIAKEPISMETPIGDDDDSHLGDFIEDTNTVA
PADAALHASMRDVVKDVLDSLTPREAKVLRMRFGIEMSTDHTLEEVGKQFDVTRERIRQI
EAKALRKLRHPSRSDKLKSFLEGN