Protein Info for H281DRAFT_05973 in Paraburkholderia bryophila 376MFSha3.1

Annotation: carbon-monoxide dehydrogenase small subunit

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF00111: Fer2
  • amino acids 10 to 63 (54 residues), 22.9 bits, E=6.7e-09
• PF01799: Fer2_2
  • amino acids 77 to 147 (71 residues), 103.6 bits, E=5e-34

Best Hits

Swiss-Prot: 49% identical to CDHC_PSEU3: Caffeine dehydrogenase subunit gamma (cdhC) from Pseudomonas sp. (strain CBB1)

KEGG orthology group: None (inferred from 55% identity to mes:Meso_0472)

MetaCyc: 50% identical to 4-hydroxybenzoyl-CoA reductase, gamma subunit (Aromatoleum aromaticum EbN1)
OHBENZCOARED-RXN [EC: 1.1.7.1]

Predicted SEED Role

"Carbon monoxide dehydrogenase small chain (EC 1.2.99.2)" in subsystem CO Dehydrogenase (EC 1.2.99.2)

MetaCyc Pathways

• phenol degradation II (anaerobic) (1/4 steps found)
• 4-coumarate degradation (anaerobic) (2/6 steps found)
• 4-ethylphenol degradation (anaerobic) (2/6 steps found)
• anaerobic aromatic compound degradation (Thauera aromatica) (6/27 steps found)

KEGG Metabolic Maps

• Methane metabolism
• Trinitrotoluene degradation

Isozymes

Compare fitness of predicted isozymes for: 1.2.99.2

Use Curated BLAST to search for 1.1.7.1 or 1.2.99.2

Protein Sequence (163 amino acids)

>H281DRAFT_05973 carbon-monoxide dehydrogenase small subunit (Paraburkholderia bryophila 376MFSha3.1)
MKGTIEVRLTLNGEPRSERVDSRLLLVELIRDALDAKGTRIGCLTGDCGACTVLLDGEVR
KSCLVLAASISGNDVRTIEGLSGIEALQEAFIAENGFQCGFCTSGMLIAAADLLRHNSSP
SHEEIRHAISGNLCRCTGYESIVNAIHRAAHGDKTCAAADNPG