Protein Info for H281DRAFT_05955 in Paraburkholderia bryophila 376MFSha3.1

Annotation: Predicted arabinose efflux permease, MFS family

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 412 signal peptide" amino acids 1 to 19 (19 residues), see Phobius details transmembrane" amino acids 46 to 66 (21 residues), see Phobius details amino acids 87 to 111 (25 residues), see Phobius details amino acids 183 to 200 (18 residues), see Phobius details amino acids 231 to 249 (19 residues), see Phobius details amino acids 263 to 282 (20 residues), see Phobius details amino acids 294 to 312 (19 residues), see Phobius details amino acids 318 to 340 (23 residues), see Phobius details amino acids 352 to 371 (20 residues), see Phobius details amino acids 383 to 401 (19 residues), see Phobius details PF07690: MFS_1" amino acids 27 to 364 (338 residues), 70.3 bits, see alignment E=1.4e-23 PF05977: MFS_3" amino acids 28 to 400 (373 residues), 105.2 bits, see alignment E=3.2e-34

Best Hits

KEGG orthology group: None (inferred from 89% identity to bph:Bphy_6034)

Predicted SEED Role

"MFS permease"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (412 amino acids)

>H281DRAFT_05955 Predicted arabinose efflux permease, MFS family (Paraburkholderia bryophila 376MFSha3.1)
MTMAAQTGFVSRLFPALAEASLRRYLSGQVASVLGSWTQNVTLNLLVYHLSGSAAILALL
NFLLYGPQLIVAPIAGSRISSANAKRATLCVLTASLVLTASLFTLSLLGVLGVKLILAHA
LAIGVSSAVETPARQVLLLTSLEDPTHTSNAVAMNTMVYNVGRMVGPTIAGFVYPTLGPR
TSFVIYAVALCFMATCVRSIRTASAARPARADSSLRDAVGYVMSDAFSARYLPILACIGL
FAGSYQTLVPLLADQGFHDAARFTGVFFACAGAGSLSAAILLSSAIGTSASRRFIAWAPW
TAVGALALLAATSEAAATVPAFFALGFSLTFAATSTNATIQRQCPEHVRGGLVGMYGMAY
NGTMPFGYLLVGTASEALGVRHTFASMAVVLASGVIAVIAWQRFTNQRAGAQ