Protein Info for H281DRAFT_05948 in Paraburkholderia bryophila 376MFSha3.1

Annotation: monosaccharide ABC transporter membrane protein, CUT2 family

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 323 transmembrane" amino acids 22 to 45 (24 residues), see Phobius details amino acids 52 to 74 (23 residues), see Phobius details amino acids 103 to 124 (22 residues), see Phobius details amino acids 132 to 150 (19 residues), see Phobius details amino acids 171 to 190 (20 residues), see Phobius details amino acids 221 to 241 (21 residues), see Phobius details amino acids 252 to 270 (19 residues), see Phobius details amino acids 276 to 297 (22 residues), see Phobius details amino acids 303 to 321 (19 residues), see Phobius details PF02653: BPD_transp_2" amino acids 51 to 313 (263 residues), 97.5 bits, see alignment E=3.9e-32

Best Hits

KEGG orthology group: K02057, simple sugar transport system permease protein (inferred from 89% identity to bug:BC1001_0566)

Predicted SEED Role

"Ribose ABC transport system, permease protein RbsC (TC 3.A.1.2.1)" in subsystem D-ribose utilization (TC 3.A.1.2.1)

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A2Z5MIQ9 at UniProt or InterPro

Protein Sequence (323 amino acids)

>H281DRAFT_05948 monosaccharide ABC transporter membrane protein, CUT2 family (Paraburkholderia bryophila 376MFSha3.1)
MNTLAENNTSAWSRIKAIQAPWVWSFIGAVLVWLAIVAIFGFGIASNVAQTALTYGVFMV
LVGLGQMLVITSGVGNIDLSVPSTIALAGVVGMHTMGGANGQIVAGIAAALGVGVAIGLA
NYALIRMLRIPPIIATLSSSFIIQSIAITQGRQLPPPPPALGAFATGRFLSVPYIALLAL
ALSIALAVLLHRAVYGRRLSAIGQNARAAWLAGVDVHRTRCLAYVMSSMIASLTALLISA
TSGGASLDMGVEYMLISIAVVVIGGTLVAGGKATIAGVWGASMFLFLTNAVLNAVGADAG
VRSIVYGALIIAVTVAAGGKGVR